KEGG   Bradyrhizobium icense: LMTR13_22960Help
Entry
LMTR13_22960      CDS       T04485                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
bic  Bradyrhizobium icense
Brite
Enzymes [BR:bic01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     LMTR13_22960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_2 GST_N_3 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ANW02603
UniProt: A0A1B1UIT0
LinkDB All DBs
Position
complement(4838368..4839072)
Genome map
AA seq 234 aa AA seqDB search
MTDLSAFSITKRWPAKHPDRLQLYSLPTPNGVKVSIMLEEIGLPYEVHLVDFNKDDQKTP
EFLSLNPNGKIPAILDPDGPGGRPLPLFESGAILQYLADKTGKLLPADPARRYQTIQWVH
FQMGGIGPMFGQVGFFHKFAGKEYADKRPLDRYVAESKRLLDVVEMRLAGRQWIMDDEYT
IADISMLGWVRNLIGFYGARDLVAFDTLKQVPAWLERGLARPAVQRGLEIPKRP
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatctctccgccttttcgatcaccaagcgctggcccgccaaacatcccgatcgc
cttcagctctattcgctgccgacgccgaacggcgtcaaggtctcgatcatgctggaagag
atcggcttgccctacgaggtgcatctggttgacttcaacaaggacgaccagaagacaccg
gaattcctgtcgctgaatccgaacggcaagatcccggccatcctcgatccggatggtccc
ggaggcagaccgctgccgctattcgagtccggcgcgatcctgcaatatctcgctgacaag
accggtaagcttctgccggccgatccggcgcggcgataccagaccatccagtgggtacat
ttccagatgggcgggatcggaccgatgttcgggcaggtcggctttttccacaaattcgcc
ggcaaggagtatgccgacaagcgtccgctcgatcgctatgtcgctgagtcgaagcgcctg
ctcgatgtggtggaaatgcggcttgccggacggcaatggatcatggacgacgaatatacc
atcgccgatatttccatgctcggctgggtgcgcaacctgatcggcttctacggtgcgcgc
gatctcgtcgcgttcgatacgctgaagcaggtgccggcatggctggaacgcgggctcgcc
cggccggcggtgcagcgcgggctggagatacccaagcggccttaa

DBGET integrated database retrieval system