KEGG   Bradyrhizobium icense: LMTR13_29175Help
Entry
LMTR13_29175      CDS       T04485                                 

Definition
(GenBank) nitrate ABC transporter, permease protein
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
bic  Bradyrhizobium icense
Pathway
bic00910  Nitrogen metabolism
bic02010  ABC transporters
Module
bic_M00438  Nitrate/nitrite transport system
bic_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:bic00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    LMTR13_29175
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    LMTR13_29175
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bic02000]
    LMTR13_29175
Transporters [BR:bic02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    LMTR13_29175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 SoxY
Motif
Other DBs
NCBI-ProteinID: ANW03612
UniProt: A0A1B1ULD8
LinkDB All DBs
Position
complement(6265369..6266280)
Genome map
AA seq 303 aa AA seqDB search
MSMHAIKAEATAVALPAASPPTSAAPVVTMTPKQAPRAEKYVKMAKETAVRVVPPLVVLA
LLLLFWELVCRRTGSTLPPPSRVFSDTKELIFDPFFDNGGIDKGLFWHLSASLQRVAYGY
SIAAIVGIALGTLVGQSVWAMRGLDPLFQVLRTIPPLAWLPLSLAAFRDGQPSAIFVIFI
TSVWPIIINTAVGIRNIPQDYRNVAAVVQLNPLEFFAKIMIPAAAPYIFTGLRIGIGLSW
LAIVAAEMLIGGVGIGFFIWDAWNSSHISEIILALFYVGIIGFVLDRVIAGLAKIVTRGT
ALN
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatgcatgcgatcaaagccgaagccaccgctgtagcccttcctgctgcctcgccg
ccgacctctgcggcgccggtggtgacgatgacgccgaagcaggcgcctcgtgcggagaaa
tacgtcaagatggcgaaggagaccgcggtgcgcgtcgtaccgccgctggtcgtgctcgcg
ctcctgttgctgttctgggaactggtctgccgccgcaccggctcgaccctgccgccgccg
tcgcgcgttttcagcgacaccaaggaactgatcttcgatccgttcttcgataacggcggc
atcgacaagggcctgttctggcatctgtcggccagccttcagcgcgtcgcgtatggttac
tcgattgccgcgatcgtcggcatcgcgctcggcacgctggtcgggcaatcggtgtgggcg
atgcgcggcctcgatccgctgtttcaggtgctgcgcaccattccgccgcttgcctggctg
ccgctgtcgcttgccgcattccgtgacggtcagccctcggcgatcttcgtcatcttcatc
acctcggtatggccgatcatcatcaacaccgcggtcggcatccgcaacattccgcaggat
taccgcaacgtcgcagccgtcgtgcagctcaatccgctggagttcttcgccaagatcatg
atcccggcggcggcgccctacatcttcacgggccttcgcattggcatcggcctgtcgtgg
ctggcgatcgtcgcggcggagatgctgatcggcggcgtcggcatcggcttcttcatctgg
gacgcctggaattcctcgcacatcagcgaaatcatcctggcgctgttctatgtcggcatc
atcggcttcgtgctcgaccgcgtgatcgcgggactggcgaagatcgtgacccgcggcacc
gcgctgaactga

DBGET integrated database retrieval system