KEGG   Bradyrhizobium icense: LMTR13_31855Help
Entry
LMTR13_31855      CDS       T04485                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bic  Bradyrhizobium icense
Pathway
bic00564  Glycerophospholipid metabolism
bic01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bic00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    LMTR13_31855
Enzymes [BR:bic01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     LMTR13_31855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ANW04057
UniProt: A0A1B1UMR2
LinkDB All DBs
Position
complement(6891699..6893243)
Genome map
AA seq 514 aa AA seqDB search
MDRTFDLAIIGGGINGCGIARDAVGRGNSVFLCEMNDLASGTSSWSTKLVHGGLRYLEYY
EFRLVREALIEREILWQIAPHIIRPLRFVLPHHSGLRPAWLLRLGLFLYDHIGGRHLLPP
TRSVDLVHDEVGKPLIANRYRKGFEYSDCFVDDARLVVLTARDAADRGAEIHTRSRAVEI
GQVDGIWHVTVEKAISGERATIQARALVNAGGPWVEQVLSTGSGVNARAKVRLVQGSHIV
VRKLYEHDRAYIFQNADGRIIFVIPYQGDFTLIGTTDRDYDGDPAKVKASPEEIQYLCAS
ASEYLKKPVLPADVVWTYSGVRPLYDDGASEAKAATRDYVFELDTPGGAPLLSIYGGKIT
TYRRLAEEALERLAPYLHSAKEKEGWTGKAPLPGGDMDVSAVAALAAELARKYPFLTSAH
AGRLAHAYGTRATKLLGSAKSLADLGQSFGATLTESEVRYLMLNEWACTAEDVVWRRSKL
GLRLSADEIAVLDEWIKANSASGEPALREAGART
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
ttggatcgaacgttcgacctcgccattatcggaggcggcatcaatggctgcggcatcgcg
cgcgatgcggtgggtcggggcaattccgttttcctctgtgaaatgaatgacttggcgagc
ggtacgtcgtcctggtcgaccaagcttgtacatggcgggctgcgctatctcgaatattac
gagttccggctggtccgtgaggcgctgatcgagcgtgaaatcctctggcagatcgcgcct
cacattatcaggccactgcgtttcgttttgccgcaccattccggcttgcggccggcctgg
ctgctcaggctagggttgttcctgtacgaccatattggtggccggcatctgctgccgccg
acacgttcggtcgatctcgttcacgacgaggtgggcaaaccgttgatcgccaaccgctac
agaaaaggcttcgaatattccgactgcttcgtcgatgacgcgcggctcgtcgtgctcacg
gcgcgggatgcggcggatcgtggcgccgaaattcacacccgctcgcgcgcggtcgagatc
gggcaggtggacggcatctggcacgtgaccgtcgagaaggccatcagcggcgagcgtgcc
accatccaggcgcgcgcgctggtcaatgccggcggcccttgggtcgagcaggtgctgtcg
acgggctcaggcgtcaacgcgcgggcaaaggtgcggctggtgcagggctcccacatcgtg
gtgcgcaagctctatgagcacgaccgcgcctacatcttccagaatgccgatggccgtatc
atcttcgtcatcccctaccagggcgactttacgctgatcggtaccaccgatcgcgactac
gatggcgatccggccaaggtgaaggccagccccgaggagattcaatatctctgtgcctcg
gccagcgagtacctgaagaagccggtgctgcccgcggatgtggtctggacttattccggg
gtccgtccgctctatgatgacggcgcgagtgaggccaaggccgcgacccgcgactacgtg
ttcgaactcgatacgccaggcggtgcgccgctgctgtcgatctatggcggcaagatcacg
acctatcggcgcctggcagaagaagcgctggagcgactcgcgccctacttgcacagtgcg
aaagagaaagaaggctggaccggcaaggcgccgctgcccggcggcgatatggatgtctcg
gcggtcgcggcgctggcggcggaactggcgcggaaatacccgttcctcacttcggcgcat
gctggccgactcgcgcatgcctacggcacgcgtgcgacaaaattgctcggcagcgcgaag
tctcttgccgatctcggtcagtccttcggtgctaccttgacggaaagcgaggtccgctac
ctgatgttgaacgaatgggcttgcaccgccgaagacgtggtgtggcgaaggtccaagctc
ggcttgcggctgtcggccgatgaaatcgccgtgcttgacgaatggatcaaggccaacagc
gcctccggtgaacctgccttgcgcgaagcgggagcgcggacatga

DBGET integrated database retrieval system