KEGG   Bradyrhizobium icense: LMTR13_32315Help
Entry
LMTR13_32315      CDS       T04485                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
bic  Bradyrhizobium icense
Pathway
bic00030  Pentose phosphate pathway
bic00710  Carbon fixation in photosynthetic organisms
bic01100  Metabolic pathways
bic01110  Biosynthesis of secondary metabolites
bic01120  Microbial metabolism in diverse environments
bic01130  Biosynthesis of antibiotics
bic01200  Carbon metabolism
bic01230  Biosynthesis of amino acids
Module
bic_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
bic_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bic_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Brite
KEGG Orthology (KO) [BR:bic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LMTR13_32315
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    LMTR13_32315
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    LMTR13_32315
Enzymes [BR:bic01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     LMTR13_32315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ANW04136
UniProt: A0A1B1UN14
LinkDB All DBs
Position
complement(6983293..6984318)
Genome map
AA seq 341 aa AA seqDB search
MKPTASATPGKPRLTTSAMIASIAAEGQRTKPAPFGHALVELARNRADVVGMTADLGKYT
DLHIFAKAFPDRYYQMGMAEQLLFGAASGLAAEGFTPFATTYAVFASRRAYDFIHQTIAE
EDRNVKIVCALPGLTSGYGPSHQAAEDLALFRAMPNMTVVDPCDAQEIEQLVPAIAAHQG
PVYVRLLRGQVPVVLDEYGYKFELGRAALIRDGSDVLIISTGLMTMRALEAAKELAGDRV
DAAVLHVPTIKPLDAETILREARKPGRLVVVAENHTVIGGLGEAVAGLLMRSGVHPVFRQ
IALPDEFLAAGALPTLHDRYGISTAEVSRQIKQWLGRSRPC
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccactgcatcagctacgccgggcaagccgcgcctgaccacgtcggccatgatc
gcctcgattgcggccgaggggcaaaggacgaagcccgcgcctttcgggcacgcactcgtc
gaactcgcccgcaaccgcgccgacgtggtcggcatgacggccgatctcggcaagtacacc
gacttgcacatcttcgccaaggcattccccgaccgctactaccagatgggcatggccgag
cagcttctgttcggcgccgcctcgggcctcgctgccgaaggcttcacgccattcgcgacg
acctatgcggtgtttgcttcccgccgcgcctatgatttcatccatcaaacgattgcggag
gaagaccgcaacgtgaagatcgtctgcgccttgcccggcctgacctccggctatggcccg
agccatcaggcggccgaggatctcgcgctgttccgcgccatgccgaacatgaccgtagtc
gatccctgcgacgcgcaggagatcgagcaactggtgccggccatcgccgcccatcaaggt
ccggtctatgtgcggctgctgcgcggccaggtaccggtggtgctggacgagtacggctac
aagttcgagctcggcagggcggccctcattcgtgacggcagcgatgtcctgatcatctcc
accggcctcatgaccatgcgtgcgctcgaagccgcgaaggagcttgccggcgatcgtgtg
gatgccgccgtgctgcacgttcctaccatcaagccgctcgatgccgagacgatcctgcgc
gaagcccgcaagccgggccgcctggtcgtcgtcgccgagaaccacacggtgatcggcggc
ctcggcgaagcggtcgcgggtttattgatgcgttcgggcgtccatccggtgttccggcag
atcgcgctgcccgacgaatttctcgctgccggcgcactgccgacgttgcacgaccgctac
ggaatttcgaccgcggaagtgtcaaggcagatcaagcagtggctagggcgctcacgaccc
tgttga

DBGET integrated database retrieval system