KEGG   Beijerinckia indica: Bind_0382Help
Entry
Bind_0382         CDS       T00688                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bid  Beijerinckia indica
Pathway
bid03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bid00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Bind_0382
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bid03400]
    Bind_0382
Enzymes [BR:bid01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Bind_0382
DNA repair and recombination proteins [BR:bid03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Bind_0382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S SPOR
Motif
Other DBs
NCBI-ProteinID: ACB94035
UniProt: B2IE11
LinkDB All DBs
Position
440927..442861
Genome map
AA seq 644 aa AA seqDB search
MAALDTHHQKRAKASPFLDSLAIQGAKKASLPEFVEPMLASLLTAPPAGKDWIHEIKFDG
YRLQARIEAGRVKLLTRRGLDWTQKFGPKIVTILQALPVETALIDGELVVENSSGVSDFS
ALQAALSEGQFDRFLFYAFDLLYLDGYDLCDLSLSKRRDMLEHLVGSDAGPLRMSQRFEE
EGRLVLQHACRLGLEGIISKRKESVYRSGRGKDWIKSKCSARQEFVIAGYVPSSTSRKAI
GSLVLGVYDGDRLDYVGRVGTGFTMAIAEDLFRKLEAMQIDKRPFAKPLASAEARHVRYV
HPELVAEIEFSGWTADERLRHASFQGLREDKDAREVVREGSRSLTFTAKPQRRRAVFTHS
DRIYWPDEGVTKEGLADYYTEVWRFIAPFIVGRPLALLRCPDGITGPQFFQKHAWKKVYS
HLVLVNDPKEKSEPLLALHDLDGLLELVQSAVLEIHPWQSTLTDWERPDRIIMDLDPGEG
VPWEMVIAAAEEMRDRLQEVGLAAFVKTSGGKGLHVVSPLKPLATWPMVKTFTKTLADAM
AADNPDRFISTSTKSKRQGKIFIDYLRNQRGMTAVAAYSTRARPGASVSVPLDWKELSPN
IGPAYFTVENTPIRLAALTGDPWAEFQAAAVALEEPRSTRRRHG
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggccgctctcgacacccatcaccagaaacgcgcgaaagcatcaccctttttagattct
ctcgccatccagggagcaaaaaaggcctcgctgcccgaatttgtcgagccgatgctggcg
agcctcttaacggccccacccgctggaaaagactggattcatgaaatcaaattcgacggc
tatcgcctgcaggcacggatcgaagccggtcgcgtcaaactgttgacccgtcgtggactg
gattggacgcagaagttcggcccaaagatcgtgactatcttgcaggctttgcccgtggaa
acagctttgatcgatggcgaactcgtggtcgagaacagctccggtgtctctgacttttcc
gcgctgcaggcggccttaagtgaggggcagtttgatcgctttctcttttatgctttcgat
ctgctttatctcgatggctatgatctgtgtgatttgtcactaagcaaacgccgggacatg
ctcgaacatcttgtcggcagcgacgctggtcctctccgcatgagccaacgctttgaagaa
gagggccgtctggtcctgcagcatgcgtgtcgtctcggtctcgaaggcatcatctccaag
cggaaggagagtgtctaccgatccggacgtggcaaggattggatcaaatcgaaatgttcg
gcgcgtcaggaattcgtcatcgccggttatgtgccctcttccacgtcccgcaaggcgatc
ggttcgcttgtgctcggcgtctatgacggagacaggcttgattatgttggccgggtcgga
acaggttttacaatggccatcgccgaggatctctttcgcaagctcgaggcgatgcagatc
gacaaaaggcctttcgcgaaacctctggcttcggccgaagcgcgtcatgtgcgctatgtc
catcccgagcttgttgcggagattgaattttctggatggaccgctgacgaacgtcttcgg
cacgcttcgtttcaagggctgagggaagacaaagatgctcgggaggttgtgcgcgagggg
tcaaggagcctaaccttcacggcaaagccacaacgacgccgggccgtattcacgcattca
gaccgtatctattggccggatgagggtgtgaccaaggaaggcctggcggattattatacg
gaggtctggcggttcatcgctccctttatcgttgggcgccctttggctctgcttcgttgt
ccggatggcattactggaccgcaattctttcaaaaacatgcctggaagaaggtctattcc
catctggttctggtcaacgatcctaaagagaaatcggagcctctcctcgcacttcatgat
ctcgatggtttactcgagcttgtgcaatcagctgtcctggagattcatccctggcaatcc
acccttactgactgggaacggccggatcgaatcatcatggatcttgaccctggtgaaggc
gttccatgggaaatggttatcgcggccgccgaggagatgcgtgatcgtttacaggaagtt
ggcctcgcggcctttgtcaaaacatcgggtggcaaaggcttgcatgtcgtctcgcctcta
aaaccgctggcgacttggcccatggtgaagactttcaccaaaaccctggctgatgccatg
gccgctgacaatcctgaccgtttcatctcaacgagcaccaagagcaagcggcaaggcaag
attttcatcgattatctgcgcaatcaacgagggatgaccgctgttgctgcttattcgacc
agggcgcggcctggagcttctgtgtcggtgcctttggactggaaggagttgagcccaaat
atcggaccagcctattttacggtggagaatacaccgatccgcttggctgcactcacggga
gatccatgggcggagtttcaggcggctgcggttgctctcgaagagccaagatcgacgaga
cgccgacatggctag

DBGET integrated database retrieval system