KEGG   Beijerinckia indica: Bind_0695Help
Entry
Bind_0695         CDS       T00688                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bid  Beijerinckia indica
Pathway
bid00473  D-Alanine metabolism
bid00550  Peptidoglycan biosynthesis
bid01100  Metabolic pathways
bid01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bid00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Bind_0695
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Bind_0695
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Bind_0695
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bid01011]
    Bind_0695
Enzymes [BR:bid01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Bind_0695
Peptidoglycan biosynthesis and degradation proteins [BR:bid01011]
 Precursor biosynthesis
  Amino acid ligase
   Bind_0695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_3 GARS_A ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ACB94345
UniProt: B2IGG3
LinkDB All DBs
Position
777866..778789
Genome map
AA seq 307 aa AA seqDB search
MAKHVAVLMGGLSAEREVSLCSGAACAEALRGEGFEVTEVDVDRQIGERLAALRPDVAFN
ALHGRFGEDGIIQGVLEMLAIPYTHSGVLASALAMRKDRARDVLAAAGVPIAKGVTVDRL
EAAQRHILPPPYVIKPLGEGSSFGVFIVREDQAYPPQELTRSDWAFGNRVLVESYIGGRE
LTCAVIGEKAHDVIEIKAVGGGWYDYDAKYRKGGSIHILPAELKRNIYQNVQLLSLKAHK
ALGCRGVSRTDFRYDDRPEGTGELIVLEVNTQPGMTETSLLPEIAAYAGLSFGELVRWMV
DDASCDR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaaacatgtggccgtgctgatgggcggtctttcggccgagcgcgaggtctcgctg
tgctcgggggcggcttgtgctgaggctctgcgcggcgaggggttcgaggtcacggaagtg
gatgtcgatcgccagatcggcgaaaggctcgcggccttgcggcctgatgtcgctttcaat
gctttgcatggccgattcggcgaggatggcatcatccagggcgttctggaaatgctggcc
attccctatacgcattcgggcgttctcgcctcggcgctcgccatgcgcaaggaccgtgcg
cgcgacgttctggccgctgcgggtgtcccgattgccaagggcgtcacggttgaccggctg
gaggcggcgcaacgccatattttgccaccgccttacgtgatcaagccgctcggcgaaggc
tcttccttcggcgtgttcatcgtgcgggaggatcaggcctatccgccacaagagttaacg
cgttccgactgggctttcggtaaccgtgttctggttgaatcctatataggagggcgcgag
ctgacctgtgccgtcatcggcgaaaaagctcatgatgtcatagagataaaggccgttggc
ggcggctggtacgattatgacgccaaatatcgaaaaggtggatctatccacatccttcct
gccgaacttaaacgaaatatttaccaaaatgttcaactcttatcgctcaaggcacataag
gccctcggctgccgtggcgtgagccggactgatttccgttacgacgaccgtcccgaaggg
acgggcgaattgatcgtcctggaagtcaacactcagcccggcatgacggagacctccttg
ctgccagaaattgcggcctatgccggtctctcgtttggtgagcttgttcgatggatggtg
gacgacgcctcctgcgatcgttga

DBGET integrated database retrieval system