KEGG   Beijerinckia indica: Bind_1352Help
Entry
Bind_1352         CDS       T00688                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bid  Beijerinckia indica
Brite
KEGG Orthology (KO) [BR:bid00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bid03012]
    Bind_1352
   03029 Mitochondrial biogenesis [BR:bid03029]
    Bind_1352
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bid04147]
    Bind_1352
Translation factors [BR:bid03012]
 Eukaryotic Type
  Elongation factors
   Bind_1352
 Prokaryotic Type
   Bind_1352
Mitochondrial biogenesis [BR:bid03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Bind_1352
Exosome [BR:bid04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Bind_1352
  Exosomal proteins of breast cancer cells
   Bind_1352
  Exosomal proteins of colorectal cancer cells
   Bind_1352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ACB94992
UniProt: B2IEH3
LinkDB All DBs
Position
1567399..1568589
Genome map
AA seq 396 aa AA seqDB search
MGKEKFERTKPHCNIGTIGHVDHGKTSLTAAITKVLAEAGGATFTAYDQIDKAPEEKARG
ITISTAHVEYETPKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKVDMVDDAELLELVELEVRELLSKYDFPGDDIPITKGSALCALE
NRNPEIGHDAVLALMQTVDDYIPQPERPIDLPFLMPVEDVFSISGRGTVVTGRVERGVIK
VGEEIEIVGLRPTVKTTVTGVEMFRKLLDQGQAGDNIGALLRGTKREDVERGQILCKPGS
VKPHTKFKAEAYILTKDEGGRHTPFFTNYRPQFYFRTTDVTGVVTLPEGTEMVMPGDNVT
MDVELIVPIAMEEKLRFAIREGGRTVGAGVVASITE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggaaaaatttgagcggacgaagccgcattgcaacattggaacgattggccat
gttgaccatggcaagacgtcactgacggcggcgatcaccaaggttctggcggaagcgggc
ggcgcgacctttacggcctatgatcagatcgacaaggcgccggaagagaaggcgcgcggc
atcacgatctcgacggcgcatgtggaatatgagacgccgaagcggcattacgcgcatgtg
gactgccccggccacgccgactatgtgaaaaacatgatcaccggcgcggcgcagatggac
ggggcgatcctggtggtttcggcggccgatggcccgatgccgcagacgcgcgagcatatt
cttctggcgcgccaggtcggtgttccggcgctggtcgtgttcctgaacaaggtcgacatg
gtcgatgacgcggaactgctcgaactcgtcgagctggaagtgcgcgagcttctgtcgaaa
tatgacttccccggcgatgacattccgatcaccaagggttcggccctgtgcgccttggaa
aaccgcaatccggaaatcggtcatgatgcggttctcgctctgatgcagacggtggatgat
tatattccgcagccggaacgtccgatcgatctgccgttcctgatgccggtggaagacgtg
ttctcgatctcaggccgcggtacggttgtgacaggccgcgtcgagcgtggcgtcatcaag
gtcggtgaggaaatcgagatcgtcggtctgcggccgacggtgaagacgacggtgaccggc
gtcgaaatgttccgcaagcttctggaccagggtcaggcgggcgacaatatcggcgctctg
ctgcgtggcaccaagcgcgaggatgtggagcgtggccagatcctgtgcaagccgggttcc
gtgaagccgcacaccaagttcaaggcggaagcctatattctgaccaaggatgagggtggc
cggcatacgccgttcttcaccaactatcgtccgcagttctatttccggacgaccgatgtg
acgggcgtcgtgacgctgccggaaggcacggaaatggtgatgcctggcgataatgtgacg
atggatgtggagctgatcgttccgatcgcgatggaagagaagctgcgcttcgccatccgc
gaaggtggccgcacggtcggcgccggcgtcgtcgcctccattaccgagtaa

DBGET integrated database retrieval system