KEGG   Beijerinckia indica: Bind_2747Help
Entry
Bind_2747         CDS       T00688                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bid  Beijerinckia indica
Pathway
bid00020  Citrate cycle (TCA cycle)
bid00190  Oxidative phosphorylation
bid00650  Butanoate metabolism
bid01100  Metabolic pathways
bid01110  Biosynthesis of secondary metabolites
bid01120  Microbial metabolism in diverse environments
bid01130  Biosynthesis of antibiotics
bid01200  Carbon metabolism
Module
bid_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bid_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bid_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bid00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bind_2747
   00650 Butanoate metabolism
    Bind_2747
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Bind_2747
Enzymes [BR:bid01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Bind_2747
    1.3.5.4  fumarate reductase (quinol)
     Bind_2747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer4_9 Fer4_7 Fer2
Motif
Other DBs
NCBI-ProteinID: ACB96319
UniProt: B2IJU4
LinkDB All DBs
Position
complement(3131933..3132712)
Genome map
AA seq 259 aa AA seqDB search
MVQFTLPKNSTVTTGKTWPKPAGAKNVKEYHIYRWNPEDGANPRIDTYFVDRDNCAPMVL
DALIYIKSNIDPTLTFRRSCREGICGSCAMNIDGTNTLACTKGMDEVKGAVKIYPLPHMM
VVKDLVPDLTNFYAQHASIEPWLKTTTPAPEKEWRQSPEDRSKLDGLYECILCACCSTSC
PSYWWNGDRYLGPAALLQAYRWLIDSRDETTGERLDNVEDPFRLYRCHTIMNCAKACPKG
LNPAKAIAEIKTMMIERQL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggttcagtttaccctccctaaaaattcgacggtgacgacaggcaagacatggccgaag
ccggctggagccaaaaacgtcaaggaatatcacatctatcgctggaacccagaggatgga
gccaatccgcgcatcgatacttatttcgtcgatcgtgacaattgtgcgccgatggttctc
gatgccttgatctatatcaagtcaaatatcgatccgacgctgaccttccgccgttcctgc
cgcgaaggcatttgtggctcatgcgccatgaatattgacggcaccaatactcttgcctgc
accaaaggcatggatgaggtcaaaggggcggtaaagatctatcctttgccgcatatgatg
gtggtcaaggatctcgtgccggatctgaccaatttctatgcgcagcatgcttcgattgag
ccttggctcaagacgacgacgccggctccggaaaaggaatggcggcaatcgcctgaggat
cgcagcaagctcgacggcctttatgagtgcatcctctgcgcctgttgctcgacctcatgc
ccgagctattggtggaatggtgaccgttatctcggtcctgccgcgctcctccaggcctat
cgttggttgatcgactctcgcgatgaaaccacgggtgagcgtctcgataatgtcgaggat
ccgttccggctctaccgctgccacaccatcatgaattgcgccaaggcttgccccaagggg
ctcaaccctgccaaagccatcgccgaaatcaagacgatgatgatcgagcgccagctctga

DBGET integrated database retrieval system