KEGG   Beijerinckia indica: Bind_2749Help
Entry
Bind_2749         CDS       T00688                                 

Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bid  Beijerinckia indica
Pathway
bid00020  Citrate cycle (TCA cycle)
bid00190  Oxidative phosphorylation
bid00650  Butanoate metabolism
bid01100  Metabolic pathways
bid01110  Biosynthesis of secondary metabolites
bid01120  Microbial metabolism in diverse environments
bid01130  Biosynthesis of antibiotics
bid01200  Carbon metabolism
Module
bid_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bid_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bid_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bid00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bind_2749
   00650 Butanoate metabolism
    Bind_2749
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Bind_2749
Enzymes [BR:bid01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Bind_2749
    1.3.5.4  fumarate reductase (quinol)
     Bind_2749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 DAO FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-ProteinID: ACB96321
UniProt: B2IJU6
LinkDB All DBs
Position
complement(3133547..3135385)
Genome map
AA seq 612 aa AA seqDB search
MALNGSSNGTAAPAYNGTAYPITDHTFDVVIVGAGGAGLRATVGCSQAGLRTACISKVFP
TRSHTVAAQGGVAASLANMGPDNWKWHMYDTVKGSDWLGDQDSIEYLCRNAPAAVFELEH
WGVPFSRTEDGRIYQRPFGGMTTDFGKGPPAQRTCAAADRTGHAILHTLYGQALRNQTEF
FIEYFAIDLIMEDGHCRGVVCLKLDDGTIHRFRSQLVILATGGYGRAYFSATSAHTCTGD
GNAMVLRAGLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLTNSSGERFMERYAPSVK
DLAPRDMVSRAMTMEIREGRGVGKGKDHIFLHLDHLDPKILHERLPGISESARIFAGVDV
TKEPIPVLPTVHYNMGGIPTNYHGEVVIKKGDDPDVVVPGLMALGEAACVSVHGANRLGS
NSLIDLVVFGRAAGLRAAEIVTAGAKQPELPAGSADLSLSRLDHFRNAKGSLPTAELRLR
MQKVMQNNCAVYRTGETLEEGSKLIHEVWKAKDQIGVTDRGLIWNTDLIETLEFDNLIVQ
AVVTMDGAVNRTESRGAHAREDYAERDDKNWMKHTLASIDGTAHTVSLDYRPVHNYTMTN
EMQYIEPKARVY
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atggcccttaacggatcatcgaacggaaccgcggcgccggcctataacgggaccgcttat
ccgatcaccgatcatacgttcgatgtggttatcgtcggtgcaggcggggctggtcttcgc
gcgaccgtgggatgttcccaggcggggcttcgcacggcctgtatttccaaggttttcccg
acccgttcgcatacggtcgcggcgcagggcggtgtcgccgcctcgctcgccaatatgggg
ccggacaattggaaatggcacatgtacgataccgtcaagggatcggactggctgggcgat
caggattccatcgaatatctctgccgcaatgcgccggcagccgtgttcgagctcgaacac
tggggcgtgccgttttcgcgcacggaagacggccgtatctatcagcggcccttcggcggt
atgaccacggatttcggcaagggtccgccggcacagcggacttgcgcggctgctgaccgc
acaggccatgccattctgcatacgctttatgggcaggccctgcgtaaccaaaccgaattc
ttcatcgaatatttcgccatcgatctaatcatggaagatggccattgccgtggtgtcgtc
tgtctcaagctcgatgatggcacgattcaccgtttccgttcccagctcgtgattctcgcg
acgggtggctatggccgcgcttatttctcggcgacatccgcccatacctgcacgggcgac
ggcaatgccatggtgctgcgtgctggtctgccgctgcaggatatggaattcgtgcaattc
catccgactggcatctatggcgcgggttgcctgatcaccgaaggcgcgcgcggcgaaggc
ggttatctgaccaattcgtcaggtgagcgtttcatggaacgctatgcgccgtcggtgaag
gatctggcgccccgcgacatggtttcgcgcgctatgacgatggagatccgcgaaggccgt
ggcgtcggtaagggcaaggatcacatctttcttcatctcgaccatctcgacccgaaaatc
ctgcatgagcggctccccggcatttcggaaagcgccaggatcttcgcgggcgtcgatgtc
acgaaggagccgatcccggttctgccgaccgtccattataacatgggcggcatcccgacg
aattatcacggcgaagtcgtcatcaagaagggtgatgatccagatgtcgtcgtgccgggc
ttgatggcgcttggcgaggcggcttgcgtgtccgtacacggcgccaatcgtcttggctcg
aattcgctgatcgatctggtggttttcggccgcgccgcgggcctccgtgccgccgagatc
gtaacggccggtgcgaaacagccggaacttccggccggttctgctgatctttcgctctcc
cgcctcgatcatttccgcaatgccaagggctcgttgcccaccgctgaactgcggttgcgg
atgcagaaggtcatgcaaaataattgcgcggtctaccggaccggcgagaccctggaagaa
ggctccaagctcatccatgaagtctggaaggctaaggatcaaatcggtgtgacggatcgc
ggtttgatctggaatacagatctgatcgagaccttggaattcgataatctgatcgtgcag
gccgtcgtcacaatggatggcgcggtcaaccgcacggaatcacgtggtgcccatgcgcgt
gaggattatgccgagcgcgatgacaagaactggatgaaacatacattggcctcgatcgat
ggcacggcccatacggtgagcctcgattaccggccggtgcataattacaccatgaccaac
gagatgcagtatattgagcccaaggcgcgtgtttattga

DBGET integrated database retrieval system