KEGG   Bacillus infantis: N288_00445Help
Entry
N288_00445        CDS       T02860                                 

Definition
(GenBank) heat shock protein Hsp33
  KO
K04083  molecular chaperone Hsp33
Organism
bif  Bacillus infantis
Brite
KEGG Orthology (KO) [BR:bif00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bif03110]
    N288_00445
Chaperones and folding catalysts [BR:bif03110]
 Heat shock proteins
  HSP33
   N288_00445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: AGX02123
UniProt: U5L4M6
LinkDB All DBs
Position
83998..84876
Genome map
AA seq 292 aa AA seqDB search
MEDYLIKALAFNGQVRAYAARSTDTVGEAQRRHYTWPTASAALGRAMTAGVMMGAMLKGE
EKLTIKIEGGGPLGPILVDSNSKGEVRGYVTHPQTHFDLNEQGKLDVRRAVGTDGMLTVV
KDIGMREHFTGQVPIVSGELGEDFTYYFAMSEQLPSSVGVGVLVNPDNTILASGGFILQL
LPGTDEETITRIENRLKEIPPVSKLIEKGLTPEELLNEILGEGNVKILEKMPVSFECTCS
KERFATSIISLGRDEIQDMIDTDGEAEAQCHFCNEKYHYSKEELEALKSEAV
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggaagattatttgattaaggcgcttgcctttaatggacaggtgcgtgcgtacgctgcc
cgcagcacagatacggtgggagaggcgcaaagaaggcattacacgtggccgacggcttct
gctgctcttggcagggcaatgactgcaggtgtgatgatgggggcgatgctgaaaggcgag
gaaaagctgaccatcaaaattgaaggcggcggcccgcttggcccaatcctggttgacagc
aattctaagggagaggtccgcggctatgtgacacatccgcagacccatttcgacttgaat
gagcaagggaagctggatgtccgcagggcagtcggtactgatggcatgctgactgtcgtc
aaggacatcgggatgagagagcatttcacaggacaggtgccaatcgtttcaggtgagctt
ggagaggatttcacttattattttgctatgtctgagcagcttccttcctctgtcggagtt
ggtgttcttgtaaatccggacaatacgattcttgcctctggagggttcattcttcagctc
cttccaggaacagatgaagagacaattacaagaattgagaacaggctgaaggaaattcct
cctgtgtccaagctgattgaaaaaggccttacaccggaagagctcttgaatgagattctt
ggagagggaaatgtaaagattctggaaaaaatgccagtatcctttgaatgcacatgctcc
aaggagcggtttgcaacgagcatcatcagcctgggcagggatgaaatccaggatatgatc
gatacagacggcgaagcagaagcccaatgccatttctgcaacgaaaaataccattactca
aaagaagagcttgaggcactaaaaagcgaagcggtataa

DBGET integrated database retrieval system