KEGG   Bacillus infantis: N288_01510Help
Entry
N288_01510        CDS       T02860                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bif  Bacillus infantis
Pathway
bif00473  D-Alanine metabolism
bif01100  Metabolic pathways
bif01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bif00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    N288_01510
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    N288_01510
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bif01011]
    N288_01510
Enzymes [BR:bif01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     N288_01510
Peptidoglycan biosynthesis and degradation proteins [BR:bif01011]
 Precursor biosynthesis
  Racemase
   N288_01510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C SH3_5 Dimerisation DUF4705
Motif
Other DBs
NCBI-ProteinID: AGX02288
UniProt: U5L4X4
LinkDB All DBs
Position
256269..257447
Genome map
AA seq 392 aa AA seqDB search
MAMDYPTGFYRDTWAEINLDHIKENVKSMKKLLPGDVKLFAVVKANGYGHGDIQAAGAAL
EAGADCLAVAFLDEALSLRQRGIEAPILVLGASRPEDAPLAASADITLTVFQVNWLEKAL
PCLQGKRLTFHVKLDTGMGRIGVREKDELLAIEKLAGREDAFELQGIYTHFATADELDDS
YFREQLGRFREMLSWLGKVPEMVHTSNSAASLRFPEARFNAVRMGISMYGLTPSPEIEHE
LPFPLKEAFSLHARIVHVKKLQKGDKVSYGATYEAEGDEWIGTLPIGYADGWIRRLQGQE
VLVNGSRVPIVGRICMDQCMIRLPYGVEPGTAATLIGAQGDSMISVNEIAAKLETINYEV
TCMISSRVPRVYKQEEKTVDLNNPLLGKQGKL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggcaatggattatcccacagggttttaccgggatacatgggctgaaattaatcttgat
catataaaagaaaatgtgaaatcaatgaagaagcttcttcctggagatgtgaagctcttt
gctgtggtgaaagcaaacggatacgggcatggagatatccaggctgcgggggcggccctt
gaggctggggcggattgcctggctgttgcctttttggatgaggctctttccctcaggcag
aggggaattgaggccccgattctggtattaggtgccagcaggcctgaggatgcaccactg
gctgcatctgcggacataaccctgacggtttttcaggtaaactggctcgagaaggcactt
ccttgtctgcaagggaagagactgacttttcatgtaaagctcgataccggaatgggtcgg
atcggcgtaagggagaaggacgagctgcttgccattgagaagcttgcagggcgggaggat
gcctttgagctgcaaggcatctatactcattttgcaacagctgatgaactggacgattcc
tatttccgggagcagctcggcagattcagggaaatgctgtcatggctcggcaaggtgccg
gaaatggtccataccagcaacagtgctgcttcgctcagatttccagaagcacgctttaat
gctgtcagaatgggaatcagcatgtacggcctcaccccatcgccggaaattgagcatgag
ctgccattcccgctaaaggaggctttctcgcttcatgccaggatcgtgcatgtgaaaaag
ctccaaaaaggtgataaagtcagctatggcgccacctatgaagcagaaggcgacgaatgg
atcggcaccctcccaatcggctatgcagacggctggatccgcaggctgcagggtcaggaa
gtgctggtgaacgggagcagagtccccattgtaggaaggatctgtatggatcaatgcatg
atccgcctgccatacggggtggaacctggaacagctgcgaccttgataggtgcgcagggg
gacagtatgatctccgtcaatgaaattgcggcaaagcttgagaccatcaattacgaggtc
acctgcatgatatccagccgggtgccgcgcgtgtataagcaggaagaaaagactgtggat
ctgaataacccgcttctcggcaagcagggcaagctttga

DBGET integrated database retrieval system