KEGG   Bacillus infantis: N288_07095Help
Entry
N288_07095        CDS       T02860                                 

Definition
(GenBank) transcriptional regulator
  KO
K02250  competence protein ComK
Organism
bif  Bacillus infantis
Pathway
bif02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bif00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    N288_07095
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bif03000]
    N288_07095
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bif02044]
    N288_07095
Transcription factors [BR:bif03000]
 Prokaryotic type
  Other transcription factors
   Others
    N288_07095
Secretion system [BR:bif02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) related proteins
   N288_07095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComK
Motif
Other DBs
NCBI-ProteinID: AGX03350
UniProt: U5L7F0
LinkDB All DBs
Position
1271892..1272464
Genome map
AA seq 190 aa AA seqDB search
MDMHKKRLVEEYEINPSTMIILPQIYGKKIYSRIFEVEDEFLSPFKLFDIVKKSCGYFGS
SYEGRKDATKDIIGVTHKVPIVIDPTNLLYFFPTTSPNNPDCIWISYEHIAAHHRTDPSH
TKVVFGNKHTLILPVSSSSFENQLLRTAHLRTKLHQRIEGHGRKMFYFTDNQRLNRASEP
VGSYRNRKLE
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
ttggatatgcataaaaaaagattggtggaggagtacgaaataaatccttctacgatgatc
atcctgccgcagatatacggcaaaaaaatttattcgcggatctttgaggtggaagatgaa
ttcctgtccccgttcaaactgtttgatatcgtcaaaaaaagctgcggctactttggctcc
tcttatgagggacggaaggatgcgaccaaggatatcattggcgtgacgcataaagtccca
attgtcatcgatccgacaaacctgctgtatttttttccgacaacttccccgaacaacccc
gactgcatctggatctcttatgagcatattgcagcccaccatcgtacagatccctcacat
accaaggtcgtattcggaaacaagcatacactgatcctccctgtatcatccagctcattt
gaaaatcagctcctccggacagctcatctaaggacaaagcttcatcagcggatcgaaggg
catggcaggaagatgttctatttcacagataatcagaggctcaacagggcttcagaaccc
gtcgggagctaccggaacaggaagctcgagtga

DBGET integrated database retrieval system