KEGG   Bacillus infantis: N288_19600Help
Entry
N288_19600        CDS       T02860                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bif  Bacillus infantis
Pathway
bif00020  Citrate cycle (TCA cycle)
bif00480  Glutathione metabolism
bif01100  Metabolic pathways
bif01110  Biosynthesis of secondary metabolites
bif01120  Microbial metabolism in diverse environments
bif01130  Biosynthesis of antibiotics
bif01200  Carbon metabolism
bif01210  2-Oxocarboxylic acid metabolism
bif01230  Biosynthesis of amino acids
Module
bif_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bif_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bif00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    N288_19600
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    N288_19600
Enzymes [BR:bif01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     N288_19600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AGX05796
UniProt: U5LGM1
LinkDB All DBs
Position
complement(3601983..3603392)
Genome map
AA seq 469 aa AA seqDB search
MIGCTFKLPFPGENRAPIGISGQLFPAGLCCWGDVCRPMLKNLEGETMQGEKITVTNGAL
NVPNNPIVPFIEGDGTGPDIWASASRVLDAAVEKAYNGERKIVWKEVLAGEKAFNQTGEW
LPSETLELINEYLIAIKGPLTTPIGGGIRSLNVALRQELDLYVCLRPVRWFEGVPSPVKR
PQDTDMVIFRENTEDIYAGIEYAKGSDEVKKLITFLQNEMGVNKIRFPETSGIGIKPVSE
EGTSRLVRAAIDYAIKEGRKSVTLVHKGNIMKFTEGAFKNWGYELAEKEYGDKVFTWAQY
DRIKEEQGTEAANNAQADAEAAGKIIVKDAIADIFLQQILTRPREFDVVATMNLNGDYIS
DALAAQVGGIGIAPGANINYVTGHAIFEATHGTAPKYAGLDKVNPSSVILSGVLLLEHLG
WTEAANLIVKSMENTIASKVVTYDFARLMDGATEVKCSEFGDELIKNMK
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgataggctgcacttttaaacttccgtttcctggagaaaaccgcgcaccgatcggcatt
tccggccagctttttcccgctggtctctgctgctggggtgatgtgtgccggcctatgctt
aagaatttggagggagaaaccatgcaaggtgaaaaaattactgtaacgaacggcgcttta
aacgtgcctaacaatcctatcgtcccatttatcgagggagatggaactggaccggatatt
tgggcttcagcatcaagagtattggatgctgcagttgagaaagcttataatggcgagcgc
aaaatcgtctggaaagaggttcttgcaggtgaaaaggcattcaaccagacgggcgaatgg
cttccatctgaaacgcttgaacttatcaacgaatacctgattgcgattaaaggtccgctg
acaactccaatcggaggcgggatccgttcattgaacgttgcccttcgccaggagcttgac
ctgtatgtctgcctgcgccctgtacgctggttcgaaggtgtcccatctccagtcaagcgt
cctcaggatactgatatggttattttccgcgaaaatacggaagatatctatgcagggatt
gaatatgcaaaaggctctgatgaagtgaagaagctgatcactttccttcaaaacgaaatg
ggcgtcaataagatccgtttccctgagacatcaggaatcggcatcaagccagtgtctgaa
gaaggcacaagccgtttagtccgtgcagctattgattatgccatcaaggaaggccgcaaa
tcagtaacgcttgtacataaaggcaatatcatgaagttcacagaaggcgcattcaaaaac
tggggctatgagttggctgagaaggaatacggcgacaaagtattcacttgggcccagtat
gaccgcatcaaagaagagcaggggacagaagctgccaataatgcacaggctgatgcagaa
gctgcaggcaaaatcatcgtcaaggatgccattgccgatatcttccttcagcagatcctt
acacgtccgcgcgagtttgatgtagtggctacaatgaacctgaacggagattatatctct
gatgcactggctgcacaggtaggcggcatcggaatcgctcctggagcaaacatcaactat
gtaacaggacatgcaatctttgaagcaacccacggcactgcacctaagtatgccggtctt
gataaagttaatccatcttcagttatcctgtcaggcgtattgctgcttgagcatcttggc
tggactgaagctgcgaacttaatcgtcaaatccatggaaaatacaattgcatcaaaagtt
gtgacttatgactttgcgcgtctgatggacggtgcgacagaagtgaaatgttctgagttc
ggcgatgagctgatcaagaacatgaagtaa

DBGET integrated database retrieval system