KEGG   Bacillus infantis: N288_22365
Entry
N288_22365        CDS       T02860                                 

Definition
(GenBank) sucrose phosphorylase
  KO
K21350  sucrose 6(F)-phosphate phosphorylase [EC:2.4.1.329]
Organism
bif  Bacillus infantis
Brite
KEGG Orthology (KO) [BR:bif00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    N288_22365
Enzymes [BR:bif01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.329  sucrose 6F-phosphate phosphorylase
     N288_22365
SSDB
Motif
Pfam: Alpha-amylase
Other DBs
NCBI-ProteinID: AGX06313
UniProt: U5LFX9
LinkDB
Position
complement(4135621..4137090)
AA seq 489 aa
MAVKNQVQLITYPDSLGGDLKMLNKVMTEHFADIFKGGVHILPPFPSSGDRGFAPLTYLE
IDPEFGGWEDIRKIGENFDILVDLMVNHISQKSEYFQDFLAKGRQSQYADLFITLDKLWE
DGQPVQEDIDKMFLRRPLPYSTFTIEETGEQETVWTTFGKTDPSEQIDLDIKSEQVRQLL
TDFFTNFKEQNVKIVRLDAVGYVVKKLGTSCFFVEPEIYEFLDWIMELANSLGIELLPEV
HSHYSIQHKLAEHGFWIYDFILPYRVLETLINKSSKNLAIYLKNRPHKQFTMLDCHDGIP
VKPDLDGLIDTKEAKDIVDVCLERGSNLSLILSDEHKAEDGFDVHQIRCSYYSVLNSDDD
AYLAARAIQFFTPGVPQVYYVGLLAGENDVENVARTGEGREINRHNFTLEEIEESLEKPV
VQRLLKLIRFRNENEAFSGEFQVLDSPDSEIRLSWRNGSKHCSLFIDLETNRSTIEYVGE
SGEMAQYNI
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggcagttaaaaatcaagtacagcttatcacatatccggactccctcggcggagatctg
aaaatgctcaacaaagtaatgacagaacattttgctgatattttcaaaggcggcgtgcat
atcctcccaccttttccatcctcaggcgacaggggatttgccccgcttacctatcttgaa
atcgacccggaattcgggggatgggaagatatccggaagatcggcgaaaactttgatatc
cttgtcgacctgatggtcaaccatatctcgcagaaatccgagtacttccaggactttttg
gcaaaaggccgccagtcccagtatgccgatctgttcatcacccttgacaagctttgggaa
gacggacagcctgtacaggaggatattgacaagatgttcctgcggaggccgctcccatat
tcaaccttcacaatagaagaaacaggcgaacaggagacagtatggaccacttttggcaaa
acagacccctctgagcagattgaccttgatatcaaatcagagcaggtcaggcagctatta
accgacttcttcactaatttcaaagagcagaacgtcaaaattgtccgccttgatgcggtc
ggctatgtcgtgaaaaagcttggcaccagctgcttctttgttgaaccggaaatttatgag
ttccttgactggatcatggagctggcgaattctctgggcatcgagctactgccggaggtt
cattcgcattattccatccagcacaagcttgccgagcacggcttctggatctatgacttt
atcctgccataccgtgtcctcgaaacactgattaacaaatcaagcaagaacctggcaatt
tacctgaagaaccgcccgcataagcagttcacgatgctcgactgccatgacggcataccg
gtcaagcctgaccttgacggcctcatcgatacaaaggaagcgaaagacattgtggatgtc
tgccttgaaagggggtccaatctgagcctgattctttctgacgaacataaagcagaggat
gggtttgatgtccaccagatccgctgctcctactattccgtcctgaacagcgacgatgat
gcctatcttgctgcaagagccattcagttctttaccccgggcgttccgcaggtctattat
gttggactgcttgccggggagaatgatgtggaaaatgtagcacgcaccggtgaagggcgc
gaaatcaaccgccataacttcactcttgaggaaattgaagaatccctggaaaagccagtt
gttcagagactcctgaagctcatccgcttccgcaatgaaaatgaagcattcagcggcgaa
ttccaggtcctggactcacctgacagcgaaatccgcctctcctggcgaaacggcagcaaa
cactgttcactgttcattgatctggaaacgaacaggagtactattgagtatgttggtgag
agcggggaaatggcacagtataacatttaa

DBGET integrated database retrieval system