KEGG   Bacillus infantis: N288_22450Help
Entry
N288_22450        CDS       T02860                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
bif  Bacillus infantis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C Methyltransf_16 Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AGX06330
UniProt: U5LFU8
LinkDB All DBs
Position
complement(4158118..4159137)
Genome map
AA seq 339 aa AA seqDB search
MKAVQIPKAMEMEIIDTEKPVISHPEEVLVKVKRVGICGSDMHIYHGTNPLATYPRVPGH
EVAGEVVEIGSGVTGVKPGDHVVVEPIRYCGECYACRTGRPNVCSNLSVFGVHEDGGMRE
YFVLPEKQLHAADPGLDWDEIVLAEPYTIGAQSVWRGDVQEGDSVLIQGCGPIGICILKM
AKLSGAHVIMTDLKQERLAFAKENGADEVIDAGKESVEDRVMELTGGEGPNIVIDAVCLP
STFELGVNVVSPAGRVVVLGFDEKPSPISQLPITKKEVTIVGSRLQTNQFGKVISLLNEG
KLEANGFITHKFTLDEVQEAFNFVEENPDQVRKAVIVFE
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagtacaaataccaaaagcaatggaaatggaaattattgatacggaaaaaccg
gtcatctcccatcctgaagaagtacttgtaaaagtaaagcgggtagggatctgcggctcg
gatatgcatatctatcatggaaccaatccgctggccacatatccaagagttcccgggcat
gaagtcgcgggagaagtcgttgaaatagggtcaggcgttacgggcgtaaagcctggcgac
catgttgtggttgagccgatccgctattgcggagaatgctacgcatgccggacaggcaga
cctaatgtctgcagcaacctgtctgtgttcggcgtacatgaggatggcggcatgcgggaa
tatttcgtcctgccggaaaagcagcttcatgcggcagaccctggccttgactgggatgaa
atcgttctggccgaaccatatacgattggtgcccagtctgtctggagaggtgatgttcaa
gaaggtgactctgtcctcatccagggctgcggcccaatcggcatctgcatcctgaagatg
gcgaagctcagcggcgcgcatgtcatcatgactgatttaaaacaagagcgccttgcgttt
gccaaggaaaatggggctgatgaagtcattgatgccggaaaagagtccgtcgaagataga
gttatggagctgactggaggagaggggccgaatattgtcattgacgctgtgtgcctgcca
tctacttttgagctgggggtaaacgtggtttccccggcaggacgggtggttgtgctgggc
tttgacgagaagccatcgcccatttcccagcttcctatcaccaagaaggaagttaccatt
gtcggttcaagattacagacaaaccagtttggaaaagtaatttccctcctgaacgaagga
aagcttgaagcaaatggatttattactcataaatttactcttgatgaagttcaggaagcg
ttcaactttgttgaggaaaatccggaccaggtgcgcaaagcagtcattgtctttgaatga

DBGET integrated database retrieval system