KEGG   Bacillus infantis: N288_24510Help
Entry
N288_24510        CDS       T02860                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bif  Bacillus infantis
Brite
KEGG Orthology (KO) [BR:bif00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    N288_24510
Enzymes [BR:bif01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     N288_24510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored DAO FAD_binding_3 Thi4 AlaDh_PNT_C NAD_binding_8 Glutaredoxin K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AGX06737
UniProt: U5LJE0
LinkDB All DBs
Position
4628253..4629782
Genome map
AA seq 509 aa AA seqDB search
MVLDADIKAQLAQYLQLMESEVLLKVSAGSDDVSRDMLALVDELASMSSSIKVEKAELHR
TPSFSVNRIGEDTGVTFAGIPLGHEFTSLVLALLQVSGRAPKADQKVIDQIKNIKGEYRF
ESYISLSCHNCPDVVQALNLMSVLNPNITHTMIDGAAFKEEVESRDIMAVPTVFLNGESF
GSGRMSLEEILGKMGSGPDASELSDKDPYDVLVVGGGPAGASAAIYAARKGIRTGIVAER
FGGQVMDTLGIENFISVKHTEGPKLVASLEEHVKEYGIDVMNLQRAKSLEKKDLIELELE
NGAVLKSKSVILSTGARWRNVNVPGEAEFKNKGVAYCPHCDGPLFEGKDVAVIGGGNSGI
EAAIDLAGIVKHVTVLEFMPELKADAVLQDRLYSLPNVTVLKNVQTKEITGTDKVNGISY
IDRETGEEHHVELQGVFVQIGLVPNTDWLGDSIERTRFGEIIVDKHGATNVPGVFAAGDC
TDSAYKQIIISMGSGATASLGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggtactagatgcagatataaaagcacagttagctcaatatcttcaattaatggaaagc
gaggtcctgctcaaggtcagcgcaggctctgacgacgtctcccgcgatatgctggcactg
gtagacgaattggcctccatgtcatccagcattaaggtggaaaaagcagaattgcatagg
acaccaagctttagtgtgaatcggatcggtgaagatacaggagtaacttttgccggtatc
cctctaggacatgaattcacttcactggtgcttgctttgctgcaggtcagcggaagggca
cctaaagccgaccagaaggttattgaccagattaaaaacatcaaaggcgaatatcgcttt
gaatcatatatcagcctgagctgccataactgccctgatgtggtacaggcactcaatctg
atgagcgttctcaatccaaacatcacgcatacgatgattgacggcgccgctttcaaggaa
gaagtcgaaagcagagacatcatggctgttccgacagtcttcctgaacggcgaatcattc
ggcagcggccgcatgagccttgaagaaattcttggcaaaatgggcagcggcccggatgca
tccgagctgtctgataaagacccttacgatgtccttgttgtcggcggcggccctgccggc
gcgagtgcggcaatctatgcggcacgtaaaggcatccgcaccggcattgtagccgagcgt
ttcggcggccaggttatggatactcttggcatcgagaacttcatcagtgtcaagcatacg
gaaggccctaagcttgttgcaagccttgaggagcatgtgaaagagtacggcattgatgtt
atgaaccttcagcgcgcgaagagcctggaaaagaaagacctgatcgaacttgaacttgaa
aatggcgctgtgctgaagagcaagagcgtcatcctttcaacaggtgcccgctggcgcaat
gtcaacgtccctggtgaagctgagttcaagaacaaaggtgtggcatactgccctcactgt
gacggcccgctctttgaaggtaaggatgttgccgttatcggcggcggaaactccggaatt
gaagcggcaatcgacctggccggcattgtcaagcacgtaactgtccttgaattcatgcct
gagctgaaggccgatgctgtcctccaggaccgcctgtacagcctgcctaacgtaactgtc
ctgaagaacgttcagacaaaggaaatcaccggtactgataaagtgaacggcatttcctat
attgaccgtgagacaggagaagagcatcatgttgagcttcagggtgtcttcgttcaaatc
ggtcttgtgccaaacacagactggctcggcgattcaatcgagcgtacacgcttcggcgaa
atcatcgtggacaagcacggcgcgaccaatgtccctggtgtatttgcggccggcgactgc
acagacagcgcctataagcaaatcatcatttccatgggatccggcgcgactgcttccctc
ggtgcgtttgattacctgatccgcaactaa

DBGET integrated database retrieval system