KEGG   Candidatus Bipolaricaulis sp. Ch78: BIP78_1121Help
Entry
BIP78_1121        CDS       T05809                                 

Definition
(GenBank) hypothetical protein
  KO
K01091  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
bih  Candidatus Bipolaricaulis sp. Ch78
Pathway
bih00630  Glyoxylate and dicarboxylate metabolism
bih01100  Metabolic pathways
bih01110  Biosynthesis of secondary metabolites
bih01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BIP78_1121
Enzymes [BR:bih01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     BIP78_1121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase HAD_2 Hydrolase_like HAD HTH_31 HTH_AsnC-type DHC
Motif
Other DBs
NCBI-ProteinID: QAA76887
UniProt: A0A410FUY2
LinkDB All DBs
Position
1137884..1138645
Genome map
AA seq 253 aa AA seqDB search
MSGRWVLAGRVVPAWGFLFDKDGTLLTFAHWRAVMEERARRLAEELNLSEPQRQALARWM
GGSSDHGQDESWGLIPLPRPDAEQAVAERLATVLGLDRPTLHARVARVFREVDRDFPFEH
HLQPTPGAEACLRAIRRGGGRSAVVTHDVPSAAGRHLAALGWDHLVDVVIGLDGTMERKP
SPQPLLAACRALGVPPEETVMVGDTVTDLVAGRGAGCALTVGVLTGLDPREKLAPHADIV
APDLATLGLARAD
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtccgggcggtgggtgcttgcgggtcgtgtggtccccgcctggggattcctgttcgac
aaggatggcaccctcctcaccttcgcccactggcgggcggtgatggaggagcgcgcacgc
cgactggccgaggagctgaacctgagcgagccccagcggcaggcgttggcgcgatggatg
gggggaagttcggaccacggacaggatgagagctgggggctcatccctcttccccgcccc
gatgccgagcaggcggtggccgaacggcttgccaccgtgctcgggctcgatcgcccgacc
ctccacgctcgcgtagcgcgggtgttccgcgaggtcgaccgtgacttccccttcgagcat
catcttcagccaaccccaggcgccgaggcgtgcctgcgggcgatccgccgtggtgggggc
cggtccgcggttgtcacccatgacgttccgtccgcggccggccgccatctggccgcactg
gggtgggaccacctcgtggacgtggtgatcggactggacgggaccatggagcgcaagcca
agccctcaacccctgcttgcggcgtgtcgtgcgttgggcgtgcctccggaggagacggtg
atggtaggggacaccgtgaccgatctcgttgccggacgcggagcggggtgcgcactcacg
gtgggcgtgctcaccggactcgatccgcgtgagaaactggctcctcatgcggacatcgtg
gctcccgacctcgccaccctcgggctggcgcgtgccgactga

DBGET integrated database retrieval system