KEGG   Bombus impatiens (common eastern bumble bee): 100740661
Entry
100740661         CDS       T04362                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 2 isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
bim  Bombus impatiens (common eastern bumble bee)
Pathway
bim04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:bim00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100740661
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 100740661
NCBI-ProteinID: XP_003490650
LinkDB
Position
Unknown
AA seq 164 aa
MDMKSKCNTDSNSDTNQNISGNREVTSERSRARLMMQYPNIDIQEGRRLRSVRRRLFQDE
DDDNETESVRNSGVEDNCFFEETRKNRENAKERWNFDFEKEEPLPGRYVWVKLDQHGNEI
CNPLEAKNRIENLQTMQEEDVQDDDITMQDHVEGKDNEKMTDST
NT seq 495 nt   +upstreamnt  +downstreamnt
atggatatgaagtcaaaatgcaatacggattcgaattcggatacaaaccagaatatctcc
ggaaatcgagaagtaacgagcgaaagatccagggctcgactcatgatgcaatatccaaac
atcgatatacaagagggaagaagactccgtagcgtgcgaagaagactttttcaagacgaa
gacgatgataacgaaacggaatcggtacgaaattctggtgtcgaggacaactgttttttt
gaagagacacgaaaaaatcgagaaaacgctaaggaaaggtggaatttcgacttcgagaaa
gaagaacctctacctggtcgttatgtatgggtgaaacttgaccagcacggaaatgaaatc
tgtaatccgttagaggcaaaaaatcgaatagaaaatttacaaacgatgcaagaagaagac
gtgcaagacgatgacattacgatgcaggaccacgtggaaggcaaagataacgaaaaaatg
actgatagtacgtga

DBGET integrated database retrieval system