KEGG   Bombus impatiens (common eastern bumble bee): 100741336Help
Entry
100741336         CDS       T04362                                 

Definition
(RefSeq) tyrosine-protein kinase Abl isoform X1
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
bim  Bombus impatiens (common eastern bumble bee)
Brite
KEGG Orthology (KO) [BR:bim00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bim01001]
    100741336
Enzymes [BR:bim01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100741336
Protein kinases [BR:bim01001]
 Non-receptor tyrosine kinases
  ABL family
   100741336
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase F_actin_bind SH2 SH3_1 SH3_9 SH3_2 Haspin_kinase SH3_3 APH
Motif
Other DBs
NCBI-GeneID: 100741336
NCBI-ProteinID: XP_003487993
LinkDB All DBs
Position
Unknown
AA seq 1447 aa AA seqDB search
MGAQQTKERIVPVGSAARQTRKQPRNLKESRLVGSNIFTEHSEALLQSRPLPHIPALPDG
DPPNGSSIQSISQQVNIQQHTVVSSAGLLEAANRWTSKENLLAQEEDDPQLFVALYDFQA
GGENQLSLKKGEQVRILSYNKSGEWCEAHSSTGQVGWVPSNYVTPVNSLEKHSWYHGRIS
RNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINEDSEGKMFVTTESKFN
TLAELVHHHSMLADGLITQLLYPAPKHNKPTVFPLSPEPDEWEINRTDIVMRHKLGGGQY
GDVYEAVWKRYNMTVAVKTLKEDTMALKDFLEEAAIMKEMKHRNLVQLLGVCTREPPFYI
ITEFMSKGNLLDYLRNESKHQINAVVLMHMATQIASGMSYLESRNFIHRDLAARNCLVGE
NHLVKVADFGLARLMRDDTYTAHAGAKFPIKWTAPEGLAYNKFSTKSDVWAFGILLWEIA
TYGMSPYPGVDLTDVYHMLEKGYRMECPPGCPPKVYELMRQCWQWSAADRPTFKEIHHSL
ENMFQESSITEEVEKQLQGGGEIPLLSYKKSQTGSTGNIHGLVLVSEPLSSSDTTSSVTK
LSTFTGGMSSKNNSSIVQMRRSTNKKGKQAPAPPKRTSLLSSCSSFRDSAYQEQDSQNTE
TNTMTLDDATDLNGIDKILEGIARDLATMAQGTIATGGCEIEEDGEGSQGTAEPNFITQP
STSPEPIPGLTCSQKQIKPRPYPSKEPLPQKLVQVGALEVQNVKRAINRYGTLPKGARIG
AYLESLRQSGMPSNQESTTVASSMTPGTVEQHEASIDNSQHRSLSPRQSNLRSQPQMTRS
NSSSGVVNTYQPPNSPRTRVVAVRKNNQSDAVGLRTFRVSSNSNFRTASPSRSVQPSLAD
LEFPPPPADLPPPPDEIFSGQEQAELPPPISCSEISQIRNSPLSIRKAKSTDWRSKEDEN
EHQEDRNDVSNAEPSVKEACSRFGVNLRRRETQDNSCRTTDNKRTGFKSRIETIEPAAPP
EEAPPPPPPPPPPVSTNSPPDSFERKPGMKEMLELKLINEIKQSAETKHGTTTKKPGVIS
STPSALLDPASQLLSELCASFNMDSGQRHAQNEYAVSTLKTNEAIQEQQQLQIHNTHKDS
CISSPVTESILSSGSVGFKLKRVDKRNNPQKEETSDGQIIDFKARLRKVENAEREKSLEE
KSTITEQSSESEEQQDDKRRSTGSISSLKKLWENKESCDSQPHSPKLSVRGSSGKQETLD
QTEDSPEDHSGASTRSQSSGSKSDTRLWPPPEPEKPVVPAKPLKPLCSSTKHFGSSIYAT
PNCTKSQHAEDDLSKQNTDSKTAKQIVLELSTLIENSVLNLKSNSTIVMTSWLQLSDKVG
LLHGMCANLADSGIAPHARFQFRELLGKLELQARQLRAAGTRNVAENTRLLTDLQNTIKD
VVNTVQR
NT seq 4344 nt NT seq  +upstreamnt  +downstreamnt
atgggtgctcaacaaactaaggagagaattgttcctgtcggctctgctgcgcgacagacg
cgcaaacagcctaggaacctcaaggaatcccgtcttgtcggctctaatatatttacagag
cacagcgaagctcttttacaaagcagaccgctacctcacattccggcattaccagatggt
gatccaccaaatgggtccagcattcagtcaatttcacaacaagtgaatattcaacaacat
actgtggtttcttctgctggacttttggaggctgcaaacaggtggacaagtaaggaaaac
ctattggcacaagaagaagatgatcctcaactatttgtggctttatatgattttcaagca
ggtggagaaaatcagctcagtcttaagaaaggagaacaagttcgtattctaagttataat
aagagtggagaatggtgtgaagctcattcaagtactggtcaagtaggatgggttccttca
aattatgttacaccagtaaattccttggagaaacactcctggtatcatggaaggatatcc
aggaatgctgcagagtatctcctaagctctggtataaatggtagttttctggttcgtgaa
tcagaaagcagtccaggtcaacgcagtatttctctgcgatatgagggtagggtataccat
tataggattaatgaagacagtgagggaaagatgtttgttacaactgaaagcaaatttaat
actctggcagaattagtacaccaccattcaatgcttgctgatggtttaattacacaatta
ctttatcctgcaccaaagcacaataaacctactgttttcccacttagcccagaacctgat
gaatgggaaattaataggacagacatagtcatgaggcataaattaggtggggggcaatat
ggggatgtctatgaagctgtatggaagaggtataatatgactgtggctgtaaaaacctta
aaggaggatacaatggctctaaaagactttctggaggaagctgcaataatgaaggaaatg
aagcatagaaatctagttcagttattaggtgtatgtactcgggaaccgcctttctacatc
attacagagttcatgagcaaaggaaatttgctagactatttgcggaatgagagtaaacat
caaataaatgccgtcgttttgatgcatatggctacgcagatcgccagtggaatgagttac
ttggaaagcagaaatttcattcacagagatctagcggctcgaaactgcctagtgggtgaa
aatcatctggtgaaggtcgcagacttcggcttggcccggttgatgagagatgatacgtac
acggctcacgctggagcgaaattccctataaaatggactgctccagaaggactagcatat
aataaattttccacgaagtctgatgtgtgggcatttggcatcttactttgggaaatagca
acctatggaatgtctccctaccctggtgttgatttgaccgatgtctatcatatgctggaa
aaaggctacagaatggaatgtccacctggatgtccaccgaaagtatatgaattgatgcgg
caatgttggcagtggtccgctgctgataggcccactttcaaagaaattcaccactctctt
gaaaatatgtttcaagaatctagtattacagaagaagttgaaaagcaattgcaaggagga
ggagaaattcctttactttcatacaaaaaatctcagactggtagcactggaaacatccat
ggacttgttctagtttctgaaccattatcatcttcagatactaccagttcagtaacgaaa
ctgagtacattcacaggtggtatgtcgagtaagaacaatagtagtatcgtacaaatgaga
cgttctacaaataaaaaggggaaacaggctcctgcccctccaaaaagaacgagcttgctg
tcgtcgtgcagttcgttccgcgactctgcctatcaagagcaagactctcaaaacactgaa
acgaacaccatgactctcgatgatgccacggatctaaatggtattgataagattctcgaa
ggtattgcgcgagatctcgcgacgatggctcaaggaacgattgctacaggaggctgtgaa
atcgaggaggatggagagggttctcagggtacagcggaaccaaactttatcactcaacct
tcaacgtctccggaacctatacctggcttgacctgttcacaaaaacaaattaagccacga
ccttatccatcgaaagagccattaccacaaaagttggtacaagttggtgcattagaagta
cagaacgtaaaaagagccattaatcgttacggtacattgccaaaaggtgctagaattggc
gcgtatttggagtctttacgtcagagtggcatgccatcgaatcaggaatcgacgacagtg
gcttcttccatgacacctggtacagtggaacaacatgaagcatctatcgacaattcgcaa
cacagatctctttctcctcgtcaaagtaatttacgaagtcagcctcaaatgactcgtagt
aattcttcaagcggtgttgttaatacttatcaacctccaaattctccccgtactcgagta
gtagctgtaagaaagaataatcagtctgatgctgtcggtttaagaacttttcgggtttca
agtaactctaattttcgtactgcgagcccatcgagatctgttcaaccgtcgttagctgac
ttggagtttcctcctccacccgcagatttgcctcctccaccagatgaaattttttctggg
caagaacaagctgaattaccacctcctatttcttgcagcgaaatttctcaaataagaaat
tctcctttatctataagaaaagcaaagagtacagactggcgttcaaaggaggatgaaaat
gagcatcaagaagacaggaatgatgttagtaacgcagaaccctctgtaaaagaagcgtgt
tcgaggtttggagttaatttgagacgcagagaaactcaagataactcgtgtagaactacc
gataataaaagaacgggttttaagtccaggatagaaacaatcgagcctgctgcaccacca
gaagaagcaccacctcctcctccaccacctccaccaccagtttccacaaattcacctcct
gatagttttgaacggaaacctggaatgaaagagatgttggaattgaagctgataaatgaa
attaaacaaagtgcagaaactaaacatggtactactacgaaaaaacctggagtaataagc
agtactccatctgctcttttggatccagcatcacagttactttcggaactctgtgcaagt
tttaacatggattctggacaaagacacgctcaaaatgagtacgctgtatcaactttaaaa
accaacgaagcaattcaagaacaacaacaacttcaaatacataatactcataaagattca
tgcatatcttctccagtaactgagtcgatactctctagcggaagtgtcggttttaagttg
aagagagtagataagcgaaataatccgcagaaggaggagacatctgatggacaaataatc
gatttcaaggccagacttcgaaaagttgagaatgcagaaagggaaaaatcgttagaggag
aaaagtactatcactgaacaatcttcagaatcagaagaacaacaagatgataagcgcaga
agcactggtagtatcagcagtttaaagaaactttgggaaaataaagaatcctgtgatagt
cagcctcacagcccaaaactcagtgtcagaggaagtagcggtaaacaagaaactcttgac
cagacagaagattcacctgaagatcatagtggagcctcaacccgtagtcagagttctggt
agcaaaagtgatactagactatggccaccacctgaaccagaaaaaccagttgttcctgca
aaaccactaaaaccattgtgttcttcaactaaacattttggttcttcaatttatgcaaca
ccaaactgtacgaaatctcaacatgcagaagacgatctaagtaaacagaatacagactca
aaaactgcaaaacagatcgtactggagctttcaacattaattgagaacagcgtattaaat
ttgaaaagtaactcaacgatagtaatgactagctggcttcaactttcagacaaggtaggg
ctgttacatggaatgtgcgctaatctcgcagacagtggtatcgcaccgcatgcgcgattt
cagtttcgcgaacttcttggaaagttagagcttcaggcacgacaacttcgtgcagctggt
actcgaaatgtcgcagagaatacaagacttctcactgacctccaaaacacgataaaggat
gttgtcaataccgtacaaagataa

DBGET integrated database retrieval system