KEGG   Bombus impatiens (common eastern bumble bee): 100741837Help
Entry
100741837         CDS       T04362                                 

Definition
(RefSeq) arginine kinase isoform X1
  KO
K00933  creatine kinase [EC:2.7.3.2]
Organism
bim  Bombus impatiens (common eastern bumble bee)
Pathway
bim00330  Arginine and proline metabolism
bim01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bim00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    100741837
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bim04147]
    100741837
Enzymes [BR:bim01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     100741837
Exosome [BR:bim04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   100741837
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN
Motif
Other DBs
NCBI-GeneID: 100741837
NCBI-ProteinID: XP_012247304
LinkDB All DBs
Position
Unknown
AA seq 374 aa AA seqDB search
MGGCTSKDTTSNDDKKNSNMVDQAVLDKLEAGFSKVAGSDSKSLLKKYLSKEVFDQLKTK
KTSFGSTLLDVIQSGVENLDSGVGIYAPDADSYTVFADLFDPIIEDYHGGFKKTDKHPPK
DFGDVDSLGNLDPAGEFIVSTRVRCGRSLEGYPFNPCLTEAQYKEMEEKVSSTLSGLEGE
LKGTFYPLTGMSKEVQQKLIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNDAKTFLVWC
NEEDHLRIISMQMGGDLGQVYRRLVSAVNEIEKRLPFSHHDRLGFLTFCPTNLGTTVRAS
VHIKLPKLAANREKLEEIAGKFNLQVRGTRGEHTEAEGGIYDISNKRRLGLTEYQAVKEM
HDGIAELIKLEKEL
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgggcggatgtacctctaaggataccacgtcgaacgacgacaagaaaaatagcaatatg
gttgaccaggcagttttggacaaactggaagctggcttctccaaagtggctggctctgac
agcaaatctctgctgaagaagtatctgtccaaagaggtcttcgatcaactgaagacaaag
aagacttcctttggatccaccctccttgatgtgatccagtctggtgtggagaatctggac
tctggtgtcggtatctacgcgcctgatgctgattcttacacagtttttgctgacctcttc
gatcccatcattgaagactaccatggtggcttcaagaagactgacaagcatccaccaaaa
gactttggagacgtcgatagccttggcaaccttgacccagctggtgagttcatcgtctcc
acccgtgtaagatgcggccgttctctggaaggctatccattcaacccctgcctgactgaa
gctcagtacaaagaaatggaagagaaagtctctagcactctgtctggcttagagggtgaa
ctcaagggaactttctatcctctaactggtatgagcaaagaagttcagcagaaactgatc
gacgaccacttcctgttcaaggagggtgatcgcttcttgcaagctgccaatgcttgccgc
ttctggcccactggccgtggtatctaccacaacgatgccaagaccttcttggtctggtgc
aacgaggaagatcatctccgtatcatttccatgcagatgggcggtgatcttggacaggtc
taccgtcgtctggtgagcgccgtgaacgagatcgaaaaacgacttcctttctcccaccac
gaccgtcttggtttcttgaccttctgccctaccaacttaggtactactgtccgtgcctct
gtacacatcaaactgcctaaattggccgctaacagggagaagcttgaagaaattgctgga
aagttcaatctccaggtccgtggtactcgcggagagcacaccgaggccgagggtggtatc
tacgacatttccaacaaacgacgtctcggtctgaccgagtatcaggctgtgaaggagatg
cacgatggaatcgccgagctgatcaagctcgagaaagaactttaa

DBGET integrated database retrieval system