KEGG   Bombus impatiens (common eastern bumble bee): 100741891
Entry
100741891         CDS       T04362                                 

Definition
(RefSeq) uncharacterized protein LOC100741891 isoform X1
  KO
K20017  Bcl-2 family protein
Organism
bim  Bombus impatiens (common eastern bumble bee)
Pathway
bim04214  Apoptosis - fly
bim04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:bim00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    100741891
   04215 Apoptosis - multiple species
    100741891
SSDB
Motif
Pfam: Bcl-2 QueF HTH_Tnp_Tc3_2
Other DBs
NCBI-GeneID: 100741891
NCBI-ProteinID: XP_012250192
UniProt: A0A6P3V7U5
LinkDB
Position
Unknown
AA seq 337 aa
MAFCSGKDKKCICVSQDHHTETEDIHRWTLPCLCDDQEEPEKPEWQELSTEDSSMSGLVG
SLRGLEDNSGNTGQPYRRHSLALSLHSNLGAFPLPNNQEASPFHVVDSARRRFSNVSDVV
SRKISHTIRWRTVSASIELTVSQGSSLCAQYIRNRLKRSGIFHRKLGLKRMRSAMLLPGG
AVVGEVYPELVSVGAELEKMHPNLFNRVARQIGCGSFSSEQSASEAIADISREMIRNGEM
TWSKVIALYAVAGGIAVDCVRQGKPEYLPAIQRGMTDVLEEDLAAWIQANGGWSALATRY
RPVTKETTWYSRKLIFLFLFTVLLIFMISIFLKFVVL
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggcattttgtagtggtaaagacaaaaaatgcatctgtgtgtctcaagatcatcataca
gaaactgaagatattcatcgatggactttgccgtgtctttgtgacgaccaggaagagcct
gaaaagcctgaatggcaggaactctccacggaggattcttcaatgtctgggctcgtcgga
tctttacgtggcttggaggataatagtgggaacacagggcaaccgtatcgtaggcacagc
ctcgctttatctctccactcgaatttaggcgcttttccgcttcctaacaaccaagaagct
tcgccttttcacgtcgtcgattcagcacgaagaagattcagtaatgtcagcgacgttgtt
tccagaaagatttctcatacgattcgatggagaacggtttcagcttcgatcgagctcaca
gtatcacagggatcgtcgttatgtgctcaatacatccgaaatcgtttaaaacgatctgga
atttttcaccgaaagctgggtctgaaaagaatgagaagcgccatgttgcttcctggaggt
gcagtcgttggcgaagtttatccagaattagtatcagttggagctgaactggaaaagatg
catccaaatttgttcaatcgtgttgcacgacaaatcggttgtggtagtttctcatcagaa
cagtctgccagcgaggccattgccgatatctccagggaaatgatcaggaatggagaaatg
acttggagcaaagtgatagccctttacgcggttgctggtggtattgccgtagattgcgta
cgtcagggtaaacctgagtatttacctgctatacagagaggtatgacggatgtattagaa
gaagaccttgcagcatggattcaagctaacggtggatggtccgctttagcaacacgatac
agacctgttacaaaagaaacaacgtggtattcacggaaacttatatttttatttttattc
accgtcttgctcatttttatgatctctatatttttaaaatttgtagttttataa

DBGET integrated database retrieval system