KEGG   Bombus impatiens (common eastern bumble bee): 100741995Help
Entry
100741995         CDS       T04362                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial isoform X1
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
bim  Bombus impatiens (common eastern bumble bee)
Pathway
bim00020  Citrate cycle (TCA cycle)
bim00190  Oxidative phosphorylation
bim01100  Metabolic pathways
bim01200  Carbon metabolism
Module
bim_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bim_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bim_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:bim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100741995
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100741995
Enzymes [BR:bim01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100741995
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C
Motif
Other DBs
NCBI-GeneID: 100741995
NCBI-ProteinID: XP_024227174
LinkDB All DBs
Position
Unknown
AA seq 475 aa AA seqDB search
MYDTVKGSDWLGDQDAIHFLTREAPRAVYELENYGCPFSRTDDGKIYQRAFGGQSLKFGK
GGQAHRTCAAADRTGHAILHTLYGQSLRYDVHYYVEYFALDLLMFGRCCKGVLAWELETG
LLHRFRAHHTVLATGGAGRCYLSCTAAHVCTGDGMAMASRAGLPLEDMEFIQFHPTGIYG
SGILITEGSRGEGGKLLNSEGEFFMERYAPNAKDLASRDIVSRAITMEIFEGRGVGPKKD
HVFLQLHHLPTETIRTRLPGISHLAWVFSGVNVEKEPIPIIPTVHYNMGGIPTNWRAQVL
TRENEEDSVIEGLWAAGETACVSVHGANRLGANSLLELVVFGKAISDQIDCMTRPGERHE
DLPSIVGEESICRFDATRYAKGCIPIAELREEMQQTMHKYCSVFRTCDVLQRGCREMTRL
FTCDLPDICVGSRSIFNLEHRAGRSHRITKHDVGLYAHRLRGRKQKRVSRVSCSG
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtatgataccgttaaagggtctgactggctaggagatcaggatgcgatacatttccta
acaagagaagcacctcgagcagtttatgaactcgaaaattatggttgtccctttagccgt
acggacgatggaaaaatctatcaacgtgcatttggtggacaatcgttaaagtttggaaaa
ggtggtcaagctcacagaacttgtgccgccgcggatagaaccggtcacgcaatactacac
actttatatgggcagagcctccgttacgacgtccattattacgtcgagtactttgccctc
gatcttcttatgttcggacgatgctgcaagggagttttagcatgggaactagaaaccgga
cttctgcatcgcttcagggctcatcatacagtattagctacaggaggagcaggaagatgt
tacctgtcctgcaccgcggcacatgtatgcaccggagatggtatggcgatggcctccaga
gcaggattgccccttgaagatatggagttcatccagtttcatccaaccggaatatacggc
agcggcattttgataacagaaggtagccgtggagaaggcgggaagctactcaattccgaa
ggagaatttttcatggaacgatacgcgccgaacgcgaaagacctcgcctctcgcgatatc
gtatccagagcaataacaatggaaatattcgaaggaagaggtgtaggtccgaagaaagac
catgtatttttgcaactacatcacttgccaacagaaacaatacgcacgcgactaccagga
atttcgcacttagcctgggtcttcagcggcgtgaatgtagaaaaagaaccgatacctatc
attcccacagtgcactacaatatgggcggcatacccacgaactggcgagcacaggttctg
acgcgagaaaacgaggaagatagcgtgatcgaaggactctgggcagcaggtgaaaccgcg
tgcgtgtctgtccatggggccaatcggttaggcgccaatagccttctggagttagtcgtt
tttggcaaggcaatctccgatcagatcgactgcatgaccaggcctggagaacgtcacgag
gacttaccatccattgttggcgaggagtctatttgccgctttgacgcgactcgttatgca
aaaggttgtattcctatcgccgagctgcgagaagagatgcagcaaactatgcacaagtat
tgctcggtgttcagaacctgcgatgtattacaacgaggatgtcgtgagatgacgcgactc
tttacctgcgacttgccggatatatgtgtaggttcaagatcaatctttaatctggaacac
agagctggtagaagccatagaattacaaaacatgatgttggtttgtatgcacatcgttta
cgcggccgaaaacagaaaagagtctcgagggtctcatgctcgggatga

DBGET integrated database retrieval system