KEGG   Bombus impatiens (common eastern bumble bee): 100742115Help
Entry
100742115         CDS       T04362                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
bim  Bombus impatiens (common eastern bumble bee)
Pathway
bim00020  Citrate cycle (TCA cycle)
bim00190  Oxidative phosphorylation
bim01100  Metabolic pathways
bim01200  Carbon metabolism
Module
bim_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bim_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bim_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:bim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100742115
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100742115
Enzymes [BR:bim01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100742115
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA DAO HI0933_like FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 100742115
NCBI-ProteinID: XP_003493793
LinkDB All DBs
Position
Unknown
AA seq 661 aa AA seqDB search
MSGLLKLSSLLARNPPTTTLNKFGLLVITNRKLHYTPDGKAAKISDNVSKHYPLVDHTYD
AVVVGAGGAGLRAAYGLVAEGFKTAVITKLFPTRSHTVAAQGGINAALGNMEEDNWQWHM
YDTVKGSDWLGDQDAIHYMTREAPKAVIELENCGMPFSRTSDGKIYQRAFGGQSLKFGKG
GQAHRCCCVADRTGHSLLHTLYGQSLSYECNYFVEYFALDLLMEDGECRGVIALSLEDGT
LHRFHAKNTVLATGGYGRAYFSCTSAHTCTGDGTAMISRANLPNQDLEFVQFHPTGIYGA
GCLITEGSRGEGGYLVNSEGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGVGPEKDH
IYLQLHHLPPEQLAARLPGISETAMIFAGVDVTREPIPVIPTVHYNMGGIPTNYRGQVLT
RKNDEDTVVPGLYACGESACASVHGANRLGANSLLDLVVFGRACAKTIAAENKPGEAIGP
LKPNAGEESVANLDWVRNANGSISTAELRLSMQKTMQTHAAVFRTAETLQEGCQKMSALY
NKLSDLKVSDKSMIWNSDLVESLELQNLMINAMQTIVAAENRKESRGAHAREDFRDRIDE
YDYSKPIGNQEPKSLDQHWRKHTLTKINPRTGEVSIEFRPVIDNTLDKQECATVPPAIRS
Y
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtcttttgaagctatcgtctttactggcgagaaatcctcccacaacgacgttg
aacaaatttggattactggtcattacaaatcgcaaacttcattataccccagatggcaag
gctgcaaaaatctcagacaatgtttctaagcattatccattagtagatcatacttatgat
gctgttgttgtgggtgctggtggagcaggattgcgtgcagcttatggcttggtcgctgaa
ggattcaagacagcagtcattactaaactatttcctacaaggtcacatactgttgctgct
caaggaggtatcaatgctgctttgggtaatatggaggaagataactggcagtggcacatg
tatgacacagttaagggatctgactggttgggtgatcaggatgctattcattatatgaca
cgtgaagcaccaaaggcagtcattgaattggagaattgtggcatgcctttcagtcgaact
tcagatggcaaaatatatcaacgtgcttttggtggacaatccctgaaatttgggaaaggt
ggtcaagctcacagatgttgctgcgtagcagacagaacaggtcattctctacttcataca
ttatatggtcaatcattaagctatgagtgcaactattttgtcgaatacttcgccctggat
ttactaatggaggatggagagtgcagaggtgtgattgctctttctttggaggacggtaca
ctccatcgttttcatgctaaaaacacagtactagcaactggaggctatggtcgtgcatat
ttttcttgcacatctgctcatacatgcactggtgatggcactgcaatgatatctagagcc
aatttgccaaatcaggacttggaattcgtgcaattccatcctactggaatatatggagct
ggttgcctcattacagaaggcagtcgcggtgaaggaggctatctagttaatagtgaaggt
gaaaggtttatggaacgttatgctccagtcgcgaaagatttagcctctagggacgttgta
tctaggtctatgactatagaaatccgggaaggcagaggcgttggtccagagaaagatcat
atctatttgcaactccatcatttacctcctgaacagttagcagccaggctacctggtatt
tcagaaacagcaatgatatttgctggagttgatgtaacaagagaacctattcctgttata
cctacggtacactataatatgggaggaatacctacaaactacagaggtcaggttctaaca
agaaaaaatgacgaggatacagttgtgcctggactatatgcctgtggagaatcagcttgc
gcatctgttcatggtgccaatcgtcttggtgcaaattcattattagatctagttgtgttt
ggtcgtgcttgtgctaaaacaatcgcagcggaaaataagccaggagaagccattggtcct
ctgaaacctaatgctggagaagaaagtgtagcaaatttggattgggttagaaatgcaaat
ggcagtatttctacggcagaattgagattaagcatgcagaaaactatgcaaacccatgca
gccgtgttcagaacagctgaaacattacaagaaggctgtcagaagatgtctgctttatac
aacaagttgagcgatttgaaggtgtcggacaaatctatgatctggaattctgatcttgta
gagtctcttgaattacaaaacttaatgatcaatgctatgcaaacaatagtagctgcggaa
aataggaaagaaagtcgcggggctcatgcacgtgaagattttagagatagaattgatgaa
tacgattatagtaaaccgatagggaaccaggagcccaaatcactggatcaacattggcga
aaacacacacttacaaaaatcaacccacgaacaggcgaagtatctattgagtttagacca
gtcatagataatactctagataaacaagaatgtgcgacggttccacctgcaattcgttcc
tactag

DBGET integrated database retrieval system