KEGG   Bombus impatiens (common eastern bumble bee): 100743524Help
Entry
100743524         CDS       T04362                                 

Definition
(RefSeq) armadillo segment polarity protein isoform X2
  KO
K02105  catenin beta 1
Organism
bim  Bombus impatiens (common eastern bumble bee)
Pathway
bim04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:bim00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100743524
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT KAP Atx10homo_assoc V-ATPase_H_N DUF3361 RIX1 Arm_2 DUF1877
Motif
Other DBs
NCBI-GeneID: 100743524
NCBI-ProteinID: XP_003494381
LinkDB All DBs
Position
Unknown
AA seq 812 aa AA seqDB search
MSYQMSSNQSRPMSHGNYQGLGDLPMGSAKEQTLMWQQNSYMGDSGIHSGTVTQAPSLSG
KEDDEMEGDQLMFDLDQGFAQGFTQDQVDEMNQQLNHTRSQRVRAAMFPETLEEGIEIPS
TQYDPAQPTAVQRLAEPSQMLKHAVVNLINYQDDADLATRAIPELIKLLNDEDQVVVSKA
AMVVHQLSKKEASRHAIMNSSQMVAALVRAISNSDDLESTKAAVGTLHNLSHHRQGLLAI
FKSGGIPALVKLLSSPMESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVALLQRDNV
KFLAIVTDCLQILAYGNQESKLIILASQGPIELVRIMRSYDYEKLLWTTSRALKVLSVCL
SNKPVIVEAGGMQALAMHLGNPSQRLVQNCLWTLRNLSDAGTKVDGLEGLLQSLVQVLSS
TDVNVVTCAAGILSNLTCNNQRNKVTVCQVGGVDALVRTIIYADSREEISEPAVCALRHL
TSRHVEAEMAQNSVRLNYGIQVIVKLLHPPSRWPLVKAVIGLIRNLALCPANHGPLRDHG
AIHHLVRLLMRAFPETQRQQRSSVASTGSQQTSGAYADGGVRMEEIVEGTVGALHILARE
SHNRVIIRSQNVIPIFVQLLFNEIENIQRVAAGVLCELAADKEGAEMIEQEGATAPLTEL
LHSRNEGVATYAAAVLFRMSEDKPQEYKKRLSMELTNSLLREDTNLWNNADFGMGPDLQD
MLGPDQGYDGMYGQGPPSVHSSHGGRGYQPQGYDQIPVDSMQGLEIGGGSTYGAMDTMDV
AHEGDLSFDHLGELPAPPQDNNQVAAWYDTDL
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atgagttatcaaatgtcttcgaatcaatccagaccaatgtctcacgggaattatcagggt
ttgggcgatctacccatgggatctgccaaagaacaaactttgatgtggcagcaaaattct
tacatgggtgattcaggaatacattctggcactgtcacccaagcgccatctttgtcaggc
aaagaggatgacgagatggaaggcgatcagctgatgtttgatttggatcaaggatttgca
cagggttttactcaagatcaagtcgatgaaatgaatcaacaattgaatcatacaagatct
cagcgtgttcgcgcagctatgtttcctgaaacattggaggagggtatagaaattccttcg
acgcagtatgatccggctcaacctacagctgttcagagattggcagaacccagtcaaatg
ttgaagcacgcggttgtcaatttgataaactatcaggatgacgcagatctcgcaacacgt
gcaataccagaattaataaagttgttaaacgacgaggaccaagttgttgtgtctaaagca
gcgatggtagttcaccaactttccaagaaggaagcatctcgtcatgctattatgaacagt
tcgcaaatggtagctgctttagttcgtgccatttcaaacagtgatgaccttgaatcgacc
aaagcagcagtcggcaccttgcacaatttgtctcatcatagacaaggtctgctggctatt
ttcaaaagcggaggaataccagctcttgtgaagcttttgagttctccaatggaatccgta
ttgttttacgcaatcacgactctccataatttacttttacatcaggatggttctaaaatg
gctgtaaggctggccggaggattacagaaaatggttgcgctactacagcgggataacgtc
aaatttttagctatagtaaccgattgcttgcaaattcttgcatacggtaatcaagagagc
aaattaattatattagcttctcaaggaccaatagagttggtacgcataatgcgttcttac
gattatgagaagcttctatggacgacttcaagagccttgaaagtgttgtccgtttgtctt
agtaataaaccggtgatagtcgaagctggtggtatgcaagctcttgctatgcatctcggt
aatccaagccagagactcgtccaaaattgtttgtggacgttacgaaatttatcggacgct
ggcaccaaagtcgatggattagaaggtttattacagagtcttgtacaagttcttagctct
accgacgtaaatgtcgttacatgtgccgctggtattttgtcgaatttgacttgcaataat
caacgtaataaggtaacagtatgccaagtgggaggtgtcgacgctcttgtacgtacaatc
atttacgcggatagtcgggaggagatcagcgaaccagcggtatgcgcgcttcgtcatcta
acgtcacgtcacgtggaagcggaaatggcacagaattcagtccgcctaaattacggaatt
caggtcatagtaaaacttttacacccgccttcacgttggccattggttaaagctgtaata
ggattaattcgcaatttggcgctttgtcccgcgaatcacggcccgcttcgtgaccacggc
gcgattcatcatctggtcaggcttctgatgcgtgctttccccgagacacaacgacaacaa
cgttcatccgtggcaagtactggaagtcagcaaacatcaggcgcgtacgcggatggcggt
gttcgaatggaggaaatagtggaaggtactgtgggagcgcttcatatcctcgcgagggaa
tcacacaacagggtcattatcagatctcagaacgtaattccgatcttcgtacagttgcta
tttaacgagattgaaaatattcaacgcgtcgcagctggcgtactttgcgaacttgccgcg
gacaaagaaggtgccgaaatgatcgaacaagaaggtgctactgctcctttaacggagttg
cttcactctagaaacgagggtgtcgcgacttatgcggcagctgtgttgttccgcatgagc
gaagataaaccacaagaatataagaaacgactctccatggaactcaccaactctttgtta
cgcgaggatacaaatctttggaataacgctgactttgggatgggtccagatctacaggac
atgcttggccctgatcaaggctatgacggtatgtatggacaaggacctcctagtgtacac
agcagccacggaggtcgagggtatcaaccgcaaggttatgaccagataccagtagattcg
atgcaagggttggaaataggtggagggtcgacgtatggcgcgatggacactatggacgta
gcgcacgagggtgacctgagtttcgatcatttaggagagcttcctgcacccccgcaagat
aataaccaggttgcagcttggtacgacaccgatctatga

DBGET integrated database retrieval system