KEGG   Bombus impatiens (common eastern bumble bee): 100743534Help
Entry
100743534         CDS       T04362                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
bim  Bombus impatiens (common eastern bumble bee)
Pathway
bim00562  Inositol phosphate metabolism
bim01100  Metabolic pathways
bim04068  FoxO signaling pathway
bim04070  Phosphatidylinositol signaling system
bim04140  Autophagy - animal
bim04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:bim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100743534
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100743534
   04070 Phosphatidylinositol signaling system
    100743534
   04150 mTOR signaling pathway
    100743534
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100743534
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bim01009]
    100743534
Enzymes [BR:bim01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100743534
    3.1.3.48  protein-tyrosine-phosphatase
     100743534
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     100743534
Protein phosphatases and associated proteins [BR:bim01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    100743534
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase3 Y_phosphatase PTPlike_phytase DSPn
Motif
Other DBs
NCBI-GeneID: 100743534
NCBI-ProteinID: XP_012250125
LinkDB All DBs
Position
Unknown
AA seq 550 aa AA seqDB search
MQHRHCVVPHGRIHEYQWSWAILSFCYQEEVETEIIGTEGGDLKFSQPSMSNTISNMKMT
NRIKGMVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKLEGVYRNHIDDVVKLLESRHK
DHYKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRHQENVAVV
HCKAGKGRTGVMVCCYLLHTKQFPTATEALNYYGNKRTHDRKGVTIPSQRRYVDYYATLV
QEGLDYQPVTLLLRKIQLDPAPIFHGGQGYLHCVISESKKKIFSSDIVEVRKGMHTVSIP
LKHSIALTGDIRVDFFNRPKMKRKEKLFHFWFNTFFVRDYLSPEYDNGELPVERSTRALS
CDGATMELPVVMSHMKPRAGSLASLGPMPPTLVLSIDKWGLDDAHKDKHHKVYSADFKVS
LFMHRMGGNISQTVSATTNRTGEGIQIGMGGQDTPSESSEADSSECDTTGDTTGDEDGES
GESSASLVVNHHPLTHSSSRTHVSIHQRASLRETAKGLLSHGDKSRSSHRQSTGNAKRSS
ALIRSATLDT
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgcaacatagacattgtgttgttcctcacggtcgtattcatgaatatcaatggtcatgg
gcaatcttgtcattttgttatcaagaagaagtggagactgaaattattggaactgaagga
ggagatttaaaattcagtcagccaagtatgtccaacactatcagtaatatgaagatgacc
aaccgtatcaagggaatggtgagcaaacgtcgtaggcgtttcacagaagatgggtttgac
cttgatctcacatatataagagataacttaatagcaatgggatttccagctgaaaagtta
gaaggagtgtataggaatcacatagatgatgttgttaaactgttggaatctaggcataaa
gatcattataagatttacaatctatgttcagagagatcttatgattttaagaaatttaaa
caaagggtagctacatatgcgtttgatgatcataatccaccaatgttggatcaaatcaga
ccattttgcgaagacgtgcacgaatggctttctcgtcatcaggaaaatgtagctgtcgta
cactgtaaggctggtaaaggtcggacgggtgtaatggtgtgttgttaccttcttcatact
aaacaatttcccactgccacagaagcccttaattactatggaaataaaagaacacacgat
aggaagggggtaacaataccttcacagaggaggtatgtggattattatgctactcttgta
caagaaggactagattatcaaccggttacattgttgttacgaaaaatacaattggatcca
gcacctatttttcatggaggtcaaggatatttgcattgcgtaatatctgaatctaagaaa
aaaatatttagctctgatatagtagaagtacgaaaaggaatgcacacagtcagcatccct
ttaaaacacagcatagcattgacaggagatatacgagtggatttctttaataggccaaaa
atgaagcgaaaggaaaaattgtttcatttttggttcaatacattcttcgtacgagactac
ttatcgccggaatacgataatggagagttaccagttgagcgttcaactagggcattgagt
tgcgatggtgcaactatggaattaccagtggttatgtcgcacatgaaacccagagccgga
tccttagctagtctcggacctatgccacctactcttgttttaagtatagataaatggggt
ctggatgacgcgcacaaggataaacatcacaaagtgtatagcgctgattttaaagttagc
ttatttatgcatcggatgggtggtaatatatcgcaaactgtatcagcgacaacaaataga
acaggagagggtatacaaataggaatgggaggacaagataccccgagcgaatcaagcgaa
gcggatagcagtgaatgcgacacaactggtgatacaacgggagatgaagatggggaatct
ggtgagtcttctgcatctctggtggtgaatcaccatcctcttacacacagcagtagccgt
acacacgttagtatccaccaaagagctagtctcagagaaactgcaaaaggtttactctcg
catggggataaaagtagaagtagtcatcggcaaagcactggcaatgcgaaacgttcttca
gctctcatacgttcggccacgttagacacataa

DBGET integrated database retrieval system