KEGG   Bombus impatiens (common eastern bumble bee): 100743680Help
Entry
100743680         CDS       T04362                                 

Definition
(RefSeq) histone-lysine N-methyltransferase NSD2 isoform X7
  KO
K11424  histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
bim  Bombus impatiens (common eastern bumble bee)
Pathway
bim00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:bim00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100743680
Enzymes [BR:bim01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100743680
Chromosome and associated proteins [BR:bim03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100743680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PWWP SET PHD zf-HC5HC2H HMG_box PHD_2 zf-HC5HC2H_2
Motif
Other DBs
NCBI-GeneID: 100743680
NCBI-ProteinID: XP_003492658
LinkDB All DBs
Position
Unknown
AA seq 1230 aa AA seqDB search
MNSKMPRNRKYQNSPDSSNDSTDENNTVNDMDDTSDSSTNLSIMEDTTPKLVDSPIQCNW
ILGQLAWARVGNFPFWPCVITLDPVLMVYHRLKATARSQTLMIHVQYFGDKGRHSWVSSN
SMIPFTNLADFKKLSESITAEVKKRDAKYAAAFIVKPGIKSKWESAIEEAMEVESMSNDD
RAHVFKPKEKSIRNKSSKISEEKDKANKRKNSSDSNGPDFKRARQDNVYEVDKEKTDGTK
QKMLKYIENGKNHSKLNSDTPPLSPLSQRDSNDEISLVQKVEFRTEEDVDGVFEVYYERN
RDMLEDEYPDASEHDIRKYLKKTWDNMNSSFRKKYRSYVTSDTTSAHTKENSLNNEDDLL
LEINGSAKDNKRSRIKVEKEEISVSETKRNRPYNLFKGTKQEKVCQICEKTGKLTRCKGP
CYSYFHLSCVKPGESSPEHSVDENIMDDKILNDINEIKQSNTDNDENNGKSEEQEDEFFK
CIDCLSGVAPACFICNEREGDRIRCSVLACGKHYHSSCLKSWPQSHWQGGRLTCPYHVCH
TCSSDNPQDSHSRAPNEKLARCVRCPSSYHTSTSCLPAGSVILTGSQIVCPKHYQAPQPP
VNAAWCFLCTRGGSLICCDTCPTSFHLECLGIDAPDGAFICEDCETGRLPLYGEVVWVKL
GNYRWWPSRICYPHEIPENIEAIPHSPGKFCVMFLGSNNYHWIHRGRAFLYQDGDANIKP
PIGKKNRDDTYRKALEEANEIHQRLKIERAAAKDHGPRGLKPPHYVKLKMNKPVGNVKPA
EVESIVACDCDAEWENPCAPGTDCLNRILLVECSPGICPAGAKCKNQAFVQRQYPAMEPF
HTVGRGWGLRSLEHIKAGQFVIEYVGEVIDEAEYKRRLHRKKELKNENFYFLTIDNNRMI
DAEPKGNLSRFMNHSCSPNCETQKWTVNGDTRIGLFALCDIERGEELTFNYNLACDGETR
KPCLCGAPNCSGFIGLKVQKPQVTTPSTTGIQQKKFDKIDKMKRQKRLRKHVLCWSCGQE
IEKLTEFVVCDQKTCNKKYHKSCVIIDDTDSRFSCPWHHCAECRRRTSAHCSFCSAAFCQ
VHLDGNLFEYSEKAGFVCKLHESMDMQRSAEDEKDYSDNDTETDKEHSSTGSNSPLIIME
KSIPREPSPRVSIIEVHPSSEESEESQKEDDEEATQSTNFMPCEYSSKSMKRKELHRLSL
RLKGEKDQVEKFSNLTSSQLEAIIGGSLFE
NT seq 3693 nt NT seq  +upstreamnt  +downstreamnt
atgaattctaaaatgccaaggaaccgtaaatatcaaaattcaccagatagtagtaacgat
agtacagatgaaaataatacagttaacgatatggatgatacaagtgattcttctactaat
ttaagtattatggaggatactactccaaaattggttgattctcctatacagtgtaattgg
atattaggtcaattagcatgggccagagttggtaattttcctttttggccttgtgttata
acacttgatccagttctaatggtatatcatagattaaaagctactgccagatcacaaacg
ctaatgatacatgtccaatactttggcgataaaggacgtcacagttgggtttcatcaaac
tctatgattccatttacaaatcttgcagactttaaaaaattatcagaatcaataactgca
gaagtaaagaagagagatgctaaatatgccgcagcatttattgttaagcctggtataaag
tcaaaatgggaaagtgcgatcgaagaagctatggaagttgaatcaatgagtaatgatgat
agagcacatgtttttaaaccaaaggaaaaaagtataagaaataagtcatctaaaatatca
gaggaaaaggataaagctaataaaagaaaaaactcaagtgattcaaatggtcctgatttt
aaacgtgctaggcaagataatgtatatgaagtagataaagagaaaacagatggaactaaa
caaaaaatgcttaaatacattgagaatggtaaaaatcattcgaaacttaattcagatact
cctccgttatctcccttaagtcaaagagattccaatgatgaaatctctcttgtgcaaaag
gtagaatttcgtactgaagaggatgtagatggtgtctttgaagtttattacgaacggaat
cgagatatgttagaagacgaatatccggatgcgtcagaacacgatattaggaaatattta
aaaaagacttgggataacatgaattcttcttttcgcaaaaaatatcgatcatatgtaaca
tcagacactactagtgctcatacaaaagaaaattcattaaacaacgaagacgacttatta
ttagaaataaatggaagtgctaaagataataaaagatcaagaattaaagttgaaaaggaa
gagataagtgtttcagaaacgaaaagaaatagaccttataatcttttcaaaggaacaaag
caagagaaagtttgtcaaatatgtgaaaaaactgggaaattaactaggtgtaaaggtcct
tgttattcatattttcacctttcttgtgtgaaaccaggagaatctagtccagagcattct
gttgatgagaatataatggatgataaaattctcaatgatataaatgagattaaacaaagc
aatactgataatgatgagaataatggtaaatcagaagagcaagaggacgagttctttaaa
tgtatcgattgcttatcaggtgtagcacctgcttgcttcatatgtaacgaaagagaagga
gatagaataagatgttctgtgttagcttgtggaaaacattatcattcgtcttgcttgaaa
tcgtggccacagtctcattggcaaggaggccgcttaacttgcccatatcatgtatgtcat
acatgcagttcagacaatcctcaggatagtcattcaagagctccaaacgagaaattagca
cgatgcgttcgttgtccttcgtcctaccatacatctacgtcttgtttacctgctggttcg
gtaattttaactggtagccaaatagtttgtccaaagcattaccaagccccacaacctcca
gtaaacgcggcatggtgctttttatgtacaagaggcggaagtcttatctgttgtgataca
tgtccaacgtcatttcatttggaatgtttaggtattgatgctccggatggtgcatttatt
tgtgaagattgtgaaacaggcagattgcctttgtatggagaagttgtatgggttaaactt
ggtaattaccgttggtggccatctcgtatttgttatcctcatgaaattcctgaaaacata
gaagccatacctcacagtcctggtaaattttgcgtaatgtttttaggatcaaataattat
cattggattcatagaggacgcgcttttctttatcaagatggtgatgcaaacataaaacca
ccaattgggaaaaaaaatagggatgatacttatcgtaaagcattagaagaagccaatgag
attcatcagcgtttaaagatcgaaagagctgcagctaaagaccatggaccaagaggattg
aaacctccacattatgtcaaattaaagatgaataaaccagttggcaacgtaaagccagca
gaggttgaaagcatcgttgcatgcgattgtgatgcagaatgggaaaatccatgtgctcca
ggcacagattgtcttaatcgaatattattagttgaatgtagccctggtatttgcccagct
ggtgccaaatgtaaaaatcaagcatttgtacaaagacaatatccagctatggaaccattt
cataccgtaggacgtggttggggtcttagaagtttagaacatattaaagctggtcagttt
gttatagaatatgtaggtgaagttatagatgaagctgaatacaaacgaagactacatagg
aagaaggaattaaagaacgagaatttttattttttaactatagataataatagaatgatc
gacgctgaaccaaaaggcaatttaagtcgatttatgaatcattcgtgttcaccaaattgc
gaaacgcaaaaatggacggttaatggagatacgcgtataggtctgtttgcattatgcgat
atcgagcgcggcgaagaattgacctttaattataatttagcttgtgatggagaaactcga
aagccctgcctctgtggagcgccaaattgtagtggttttataggtttgaaggtacagaaa
ccacaagtaactacgccttcaacaacaggaattcaacagaaaaaatttgataaaatcgat
aaaatgaaacgtcaaaaaaggttgaggaagcatgtactgtgttggagttgtgggcaggaa
attgaaaagttgacagagtttgtcgtttgcgatcaaaagacatgcaataaaaagtatcat
aaatcttgcgtgatcattgatgatacagattcgagattcagttgtccttggcatcattgt
gcagagtgtcgtcgtagaacatctgcacattgttcgttttgtagtgctgctttttgtcaa
gtacatctggatgggaatttattcgagtatagtgaaaaagctggttttgtctgtaagttg
catgaaagtatggatatgcaaagatctgctgaggatgaaaaagattattcggataatgat
actgaaacagacaaagaacattcttctacaggttccaatagtccattgatcataatggaa
aaatcaataccgcgtgaaccatcaccaagagtttccataatagaggttcatccaagtagt
gaggaaagtgaagaatctcaaaaagaagatgatgaagaagcgacgcagtctactaatttt
atgccttgtgaatacagctcgaaaagtatgaaaagaaaagaattgcaccgattatcttta
agattgaaaggagaaaaagatcaggtagaaaaatttagtaatcttacatctagtcaattg
gaggctataatcggtggcagtttatttgaatga

DBGET integrated database retrieval system