KEGG   Bombus impatiens (common eastern bumble bee): 100744197Help
Entry
100744197         CDS       T04362                                 

Definition
(RefSeq) histone deacetylase 6
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
bim  Bombus impatiens (common eastern bumble bee)
Brite
KEGG Orthology (KO) [BR:bim00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bim01009]
    100744197
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bim03019]
    100744197
   04131 Membrane trafficking [BR:bim04131]
    100744197
   03036 Chromosome and associated proteins [BR:bim03036]
    100744197
Enzymes [BR:bim01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100744197
Protein phosphatases and associated proteins [BR:bim01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100744197
Messenger RNA biogenesis [BR:bim03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100744197
Membrane trafficking [BR:bim04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    100744197
Chromosome and associated proteins [BR:bim03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100744197
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP DUF604
Motif
Other DBs
NCBI-GeneID: 100744197
NCBI-ProteinID: XP_012249713
LinkDB All DBs
Position
Unknown
AA seq 1160 aa AA seqDB search
MSDPVICKNLYSAVKQLADSEIELIKAIENSEKINNRNIKNTMSVTDKKSAKNSAKMFNV
RPSAALIAAKHEATQRVLQRKKSNNVFVHDIYQKAIDAYNIKRKETGIVFDRSMTEHKCL
WDPSYPECPARLIRVMQRCEELGLINRCKFVTPRQASEDEILMKHSQEQIDILKATDECT
DIDSLELLSSTYDAIYIHPSTYQLSLLAVGSTINLVESICKEEIQNGMAIIRPPGHHAMK
SEYCGYCFFNNVAIAAEKVLSSNLASKILIVDWDIHHGQATQQMFYNDPRVIYFSIHRYE
NGEFWPNLRESNFHFVGDGLGEGYNFNVPLNKTGMTNADYLAIFQQVLLPMAYEFQPDLI
IVSAGYDAALGCPEGEMLLTPACYAHLLSSLLSLASGKVAVILEGGYCLKSLAESAALTL
RTLLGDPCPMLETLTLPSISVRDTILNTIYAHKPYWKCYQYQDTYSINSTTNNKEGSTNQ
YLPVVTFKGTDIKPEVYETRNCYPTQNKEVIEMIEKQLNTLIQFTNLSKAPNKVCIVYDD
RMLKHCDMSNDNHPEKPHRINIIYKKYQECNLLDRCYVQQGRSATREELILVHSKEYIDS
IKDTENLNPKELKRQAENYNSVYLHPETWTSACISTGSLLQVVDSVLNGESQSGIAIVRP
PGHHAAENTACGFCIFNNIAVAARYAVEFHHVKRVLIVDWDVHHGNGTQSIFEEDPKILY
MSVHRYDNGNFFPNSKRANYSYVGSLSGEGFTVNIPWNKKGMGDAEYIAAFQQIIMPIAY
QFNPELVLVSAGFDACIGDPLGGCFVTPEMYGHLTHWLSSLANGRIILSLEGGYNINSVA
HAMAICTKSLLGDPLPILENGQTPCASAIHTINNVIKTQKQYWTHLVFNLSLPKERVLPK
PKVPHIKTNERVIDSEEILKHSESKIALEEIETEKMQTRQKNLTTWKLINKVASQEDCEK
LQEFLKSVHERRTHTTINTSYNDEGSKYTKKCMNQDEEERHSDENITNFAAGSSGEQGER
ASAQMTGNKSLHDYLLENSQALVDGDMFAVIPLRECPHLDSVKDVPVSGIDIYSPCIECE
SNVENWICLRCYTVHCARSINQHGLIHAEEMEHPLALSFSDLSVWCYKCEAYIDNVRLFA
VRNAVHQSKFNEELPWTYEI
NT seq 3483 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatcctgtgatctgcaaaaatttatactctgctgttaaacaattagcagacagt
gaaatcgagttaataaaagctatagaaaattcagagaagataaataatagaaatattaaa
aatactatgtctgtgacagataagaaaagtgccaaaaattctgcaaaaatgtttaatgtt
cgtccatctgctgctttaatagcagctaaacatgaagcaacacaacgtgtactacaaaga
aagaaatctaacaatgtttttgtacatgatatatatcaaaaagctattgatgcatataat
ataaaaaggaaggaaactggcattgtatttgatcgttctatgacagaacataaatgcctt
tgggatccaagttatccagaatgtcctgctagattgataagagttatgcagagatgtgag
gagttaggtttaataaatagatgtaaattcgttacaccaagacaagcctcagaggatgaa
atactaatgaagcacagccaagaacagatagatattttgaaggctactgatgaatgtaca
gatatagatagtttagaattattatcatcaacatatgatgccatttatatacatccttct
acctatcaattgtctttgttagctgtgggttcaacaataaatttagtggaaagcatttgc
aaagaagaaattcagaatggtatggccattataaggccaccaggacatcatgcaatgaaa
tcagaatattgtggatattgtttcttcaataatgtcgcaattgctgctgaaaaagtttta
agtagcaatttagctagtaaaattttaattgttgattgggatatacaccatggacaagct
actcagcaaatgttctataatgacccacgagtaatttatttttcaattcaccgttatgaa
aatggagaattttggccaaatcttagagaatctaatttccattttgttggagatggttta
ggagaaggatataattttaatgtgccacttaataaaactggcatgaccaatgctgattat
ttagccatatttcaacaagttttattgccaatggcctatgagtttcaacctgatcttata
atagtatcagctggatatgatgcagcgttgggctgtcctgagggtgaaatgttgctaaca
ccagcatgttatgctcatttattatcatcattattgagtttagcctctgggaaagttgct
gttatattggagggtggttattgtttaaaatcattagcagaaagtgcagcattaacacta
cgtactttgttaggtgatccatgccctatgttagaaactcttacattaccttcaataagc
gtacgtgataccattttaaatacaatttatgcacataaaccatattggaaatgctatcaa
taccaagatacatacagtattaatagtacaacaaataataaagaaggaagtactaatcaa
tatttaccagtagttacattcaaaggaactgatattaagcctgaagtgtatgagactcga
aattgctacccaactcaaaataaagaagttatcgaaatgatagaaaagcagttaaataca
ttaatacagtttactaatttatctaaagcacctaacaaagtgtgcattgtttatgatgat
agaatgttaaaacattgtgatatgtctaatgataatcatccagaaaaaccacatcgtatt
aatattatttataaaaaatatcaagagtgcaatttacttgatcgatgttatgtgcaacag
ggacgaagtgcaacaagagaagaattaatattagtccattcaaaagaatatatagattca
ataaaagatacagaaaacttaaacccaaaagagctaaaaaggcaggcagaaaattataat
tcggtttatttgcatcctgaaacctggacaagtgcctgtatatcaactggatcattatta
caagtagttgatagcgtattaaatggagaaagtcaatccggtattgctattgttaggcct
ccaggccatcatgctgcagagaatacagcatgtggtttttgtatctttaacaatattgct
gtagcagctagatatgcggtagaatttcatcatgtaaaaagagtattgatagtagattgg
gatgtacatcatggtaatggaactcaatccatctttgaggaggaccctaaaattttgtat
atgtctgtccatcgttatgataatggcaatttttttccaaattctaaacgagcaaattac
tcttatgtcggttctctatcaggagaaggtttcactgttaacattccatggaataagaaa
ggaatgggcgatgcagaatatatagcagcatttcaacagataataatgccaattgcttat
cagtttaatccggaattagtcttagtttctgcgggtttcgatgcatgtattggggatcct
ctaggaggttgtttcgtgacaccagaaatgtacggacacttaacacattggctatcttct
ttagctaatggtcgtattattcttagtcttgaaggaggttacaatattaattcagtcgcg
catgcaatggctatttgcacaaaatctttgcttggtgatcctttaccgatattagagaat
ggacaaactccatgcgcgagcgctattcacactataaataatgttataaaaacacaaaaa
caatattggacgcatttagtatttaatttatctttaccgaaagagagagtacttcctaag
cccaaagttccacatataaagacaaatgaacgtgttatagacagtgaagaaatattaaag
cattcagaatctaagatagcattggaagaaatagaaacagaaaaaatgcaaactaggcag
aagaatcttacaacttggaagctgataaataaagtggcctcacaagaagattgtgagaaa
ttacaagagtttcttaaatctgtacatgagcgacgtacacatacaacaattaatacttct
tataatgacgaaggttccaagtatacaaagaaatgcatgaatcaggatgaagaagaaaga
cattctgatgaaaatattaccaattttgctgctggtagtagtggtgaacaaggcgaaaga
gcaagtgcgcaaatgactggaaataaaagtttacatgattatttattggaaaattcgcaa
gcattagtggatggagacatgtttgcagtgatacctttacgagaatgtccacatttggat
agtgtcaaggatgtaccagtttctggaattgatatatattcaccatgtatagaatgtgaa
agcaatgttgaaaactggatctgtttacggtgttatactgttcattgtgctcgtagtatt
aatcaacatggtttaatacacgctgaagaaatggaacatccattggccctaagtttcagt
gatttatcagtttggtgttacaaatgtgaggcatacatagataatgtgcgattattcgcc
gtgcgcaatgctgtacaccaaagtaaatttaatgaggaattaccatggacatatgaaata
taa

DBGET integrated database retrieval system