KEGG   Bombus impatiens (common eastern bumble bee): 100744462Help
Entry
100744462         CDS       T04362                                 

Definition
(RefSeq) 4-aminobutyrate aminotransferase, mitochondrial
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
bim  Bombus impatiens (common eastern bumble bee)
Pathway
bim00250  Alanine, aspartate and glutamate metabolism
bim00280  Valine, leucine and isoleucine degradation
bim00410  beta-Alanine metabolism
bim00640  Propanoate metabolism
bim00650  Butanoate metabolism
bim01100  Metabolic pathways
Module
bim_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    100744462
   00650 Butanoate metabolism
    100744462
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100744462
   00280 Valine, leucine and isoleucine degradation
    100744462
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100744462
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bim01007]
    100744462
Enzymes [BR:bim01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     100744462
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     100744462
Amino acid related enzymes [BR:bim01007]
 Aminotransferase (transaminase)
  Class III
   100744462
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 100744462
NCBI-ProteinID: XP_003492665
LinkDB All DBs
Position
Unknown
AA seq 498 aa AA seqDB search
MLANKCQTALFTQKFSRQLFKGYAISWKRCLTVSVEEPKKPIVTTEIPGPRSRSLLQELT
SMQQASSVQFFADYEKSVGNYITDVDGNTLLDVYMQISSMPLGYNHPAMLKALADPVNQK
IIANRPALGVFPGKDWPDKLRKILLHKEIAPPGLSHITTMMCGSCSNENAFKTIFIWYAE
KQRGDAPFTREEMESCMMNQTPGTPRFSILSFKGAFHGRTLGSLSTTHSKYIHKIDIPGF
DWPTASFPVYKYPLDENIRENQQEDNRCLAEVEELFEKYKTEKKIPVAGVIVEPIQAEGG
DNHASPEFFQELQRITKKHDAALLIDEVQTGGGPTGKMWCHEHFNLESPPDVVTFSKKMQ
LGGYYHVKSLKPKQSYRIFNTWMGDPSKMILLEAILETIRKENLLHRVTTVGDYMLKQLM
SLQNEFSTMINSIRGRGTFIAFNCSSPELRDTIIKKLLSKGIQTGGCGTATIRLRPALTF
TEHHANIFLDTLRSILKQ
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgctcgctaacaagtgtcaaactgcgctctttactcaaaaattttcacggcagttgttc
aaagggtatgcaatatcttggaagagatgcttgaccgtatccgtagaggaaccaaaaaaa
cctatagtaacaacagaaataccaggacctcgatctcgtagtttattgcaggaactcact
tcgatgcaacaagcctcttccgtacaattcttcgcagactacgaaaaatcagtaggtaac
tatataacggacgtcgatgggaatactctgcttgatgtttatatgcaaatttcgtcgatg
cctctgggctacaatcatccagctatgttaaaagctctcgctgatccggttaatcagaaa
attatagcaaataggcctgcgttaggtgtttttcctggaaaggattggccagataaactg
aggaaaattttgctacataaagagattgccccaccgggattgtctcacatcacaaccatg
atgtgtggctcttgttcgaatgaaaatgcatttaaaacaatttttatttggtatgctgaa
aaacaaaggggagacgctccgttcacgagagaggaaatggaaagttgtatgatgaatcaa
acacctggtactccgcgattttcgatactttcgttcaaaggtgcatttcatggacgaaca
ttgggatctctttcaacaacgcacagcaaatacattcataaaatagatattccagggttt
gattggcccaccgcgtcatttcctgtatataaatatcccttggatgaaaatattcgagaa
aatcagcaagaagataatcgatgtctagccgaagtagaggaattattcgaaaagtacaaa
actgagaagaaaattccagttgctggtgtgatagttgaaccaattcaggcggaaggaggt
gataatcacgcatctcctgaattttttcaagaattacagcgtataacaaaaaaacacgat
gcggcattattaatcgatgaagtacaaactgggggtgggccaacaggaaaaatgtggtgt
cacgaacatttcaatttagaatctcctccagatgtggtgacctttagcaagaaaatgcaa
ttgggcggctattaccatgtcaaatctttaaaacctaaacaatcctaccgtatattcaac
acctggatgggagatcccagcaaaatgatattactcgaagcaatattagagacgataagg
aaggaaaatcttttgcatagggttacgactgttggcgattatatgctaaaacaattaatg
agtttgcaaaatgaattttccacgatgattaattcgatacgtggacgtggaacgttcatt
gcatttaactgctcttcgcctgaattacgagatacgataattaagaaacttttaagcaaa
ggtattcaaaccggtggctgtggtactgcgacgataagattaagacctgccttgacattt
acggaacatcatgcgaatattttcttagatactctgcgatctatattaaaacaataa

DBGET integrated database retrieval system