KEGG   Bombus impatiens (common eastern bumble bee): 100745310Help
Entry
100745310         CDS       T04362                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
bim  Bombus impatiens (common eastern bumble bee)
Pathway
bim00052  Galactose metabolism
bim00500  Starch and sucrose metabolism
bim01100  Metabolic pathways
bim04142  Lysosome
Brite
KEGG Orthology (KO) [BR:bim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100745310
   00500 Starch and sucrose metabolism
    100745310
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100745310
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bim04147]
    100745310
Enzymes [BR:bim01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100745310
Exosome [BR:bim04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100745310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil DUF5110
Motif
Other DBs
NCBI-GeneID: 100745310
NCBI-ProteinID: XP_012245854
LinkDB All DBs
Position
Unknown
AA seq 994 aa AA seqDB search
MKKFIKTIEMNVKDIQQFVPKNKVLDRYSKYILTYNFLKLIMFIILLGVIIVFLQQSKCI
IIEEYKIDIISRNDEILQNTNYKLVNDSMILSKKENFEYDIESHDTISKFPRIVQKQCNN
IPVTLRFDCHPEDGASELSCRNRGCCWNSLNKKISTTRPVPLNLPYCYYPSDWSIYRYQN
FSKEGNNFFGFLKQIKSSFYEDDLPLVKVETSTIDDTILRIKIYDPLKKRYEPPWPLRAD
PKPFLQKNVNAKYKLEIDNTKPGFKVYRTLDDTVIFDSINTGGFIFADQFLQISTLLPSH
NIYGIGEHKTKLKLNTNWQMFTLLNKDQPPIENANLYGSHPFYLIIENSGRSHGLLFLNS
NAMDVILQPSPAITFRTIGGVFDIYFFLGPTPTDVIKQYSEIIGKPFLPPYWSLGFHLCR
YGYGTLEKTKEIWNRTIAAGIPFDTQWNDLDYMDKNNDFTYNPKTFKELPQFVNEIHSRG
MHYIPLIDAGISGSEKHGTYLPYDEGMKEDIFIKDGATDQPFVGKTWNFVSTVWPDFTNP
KTQNYYFHMMSNMHDSFAYDGAWIDMNEPSNFYDGHKNGCPKSKLDYPKYVPNVVGDILA
TKTLCMNAKHYLGLHYDLHNTYGTSQAIATNYALTNIRRKRPFIISRSTWVGHGHYAGHW
TGDVYSSWHDLKMSIPAILLMNFYQIPMVGADICGFNGNTTAALCNRWMQLGAFYPFSRN
HNSDDTIEQDPVAMGDLVIKSSKRALTIRYWLLPYLYTLLFRAHKFGETVARPLFFEYSN
DSATYDIDTQFLWGSSLMIIPVLEENKTKVSAYLPHGVWYNFYTKESVFALGKYYTMNAP
LDTIPLMIRGGSILPVQKPADTTTSSRKNNFELLITLDHVKKAKGELYWDDGDSLDSLEK
EQFVWSVFTIENNTLSAAKAMKSSFNEKMILGEIQIWGITSNISRVSLNNHEIQFKYDSK
ENCLNISNLQIDLRENFLLSWEYTDFEQHDDSNK
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatttataaaaacaatagaaatgaatgtgaaagatatacaacaatttgtacca
aaaaataaggttttagatagatattccaagtatatattaacatataattttctgaaattg
atcatgttcattattctgcttggtgtaataatagtatttttacaacaaagcaaatgcatt
attatagaagaatataaaatagatataatctctagaaatgacgaaattctacagaatacg
aattataaactggttaatgattctatgatattatctaaaaaagaaaattttgaatatgat
atagaatctcatgacacaatatcgaaatttcctagaattgtacaaaagcagtgcaacaac
attcccgttacattacgctttgattgtcatcctgaagatggagcatctgaattatcctgt
agaaatagaggttgttgctggaattctcttaacaaaaaaatatcaacgacaagacctgtt
cctttgaatcttccatattgttattatccaagtgattggagcatatacaggtatcaaaat
tttagtaaagaaggaaacaacttttttggattcctcaaacaaataaaaagctccttttat
gaagatgacctaccactggttaaagtagaaaccagcactatagatgatactattctacgt
ataaaaatatatgatcctcttaagaaacgatatgaaccaccatggcctctcagagcagat
cccaaaccatttcttcaaaaaaacgttaatgcaaaatacaaattagagattgataatact
aaacctggttttaaagtatacagaactttagatgatacagtgatatttgactctattaat
acaggaggtttcatatttgctgatcagtttttgcagataagcactcttttgccgagccat
aatatttatggtattggcgaacataaaacgaagctaaaattaaatactaattggcaaatg
tttacattattgaacaaggatcaaccaccaatagaaaatgcaaatttatatggatctcat
cccttctatctcataattgaaaattccggaaggtctcacgggcttctatttctcaatagt
aatgcaatggatgtgatattacaaccgtcgcctgctattacctttcgaactattggcggt
gtttttgatatatatttctttctgggtccaaccccgacagatgtcataaaacaatattct
gagataataggtaaaccatttctccccccatattggtcccttggttttcatttatgcaga
tacggatatggaaccttagaaaaaacaaaggaaatatggaatagaaccatagcagcggga
attccatttgatactcaatggaatgatttagattacatggataaaaataacgatttcaca
tataatccaaaaacatttaaggagttaccacaatttgtgaatgaaatacattcaagagga
atgcattatattcccttaatcgatgcgggaatatctggttctgaaaagcacggaacttat
ttgccatatgatgaaggtatgaaagaagatatatttataaaagatggagcaactgatcag
ccatttgttggcaagacgtggaattttgtttctactgtgtggcctgattttacgaatccc
aaaacgcaaaactattatttccacatgatgagcaacatgcatgatagttttgcatacgac
ggtgcttggatcgatatgaatgagccatctaatttttacgatggacataaaaatggatgt
ccaaaaagtaaattggattatccgaaatatgtaccgaacgttgtaggagacatactcgca
acaaaaacattgtgcatgaacgctaagcattacttaggtcttcattatgatcttcataat
acttatggcacaagtcaagcaatagcaacgaattatgcactgaccaatattcgacgaaaa
agaccatttataatatcgcgttcaacttgggtgggtcatgggcactatgctggtcattgg
acaggagatgtttattcctcatggcacgatttaaaaatgagtattccagcaatattgttg
atgaatttttaccaaataccaatggttggtgcagacatttgtggatttaatggaaataca
acagcggcattatgtaatcgttggatgcaacttggtgcattttatcctttttctcgtaat
cataattccgacgatacaatcgaacaagatccagttgctatgggcgatttagtaataaaa
tcatcaaagcgtgcccttacgatacgttactggttgttaccctatttatatacgttatta
tttcgagcacataaatttggagaaactgtagcacgaccactattctttgaatactcgaac
gattcggccacatacgatatcgacactcagttcttatggggtagttctttgatgataatt
ccagttttagaagaaaacaaaacgaaagtatcagcttatttaccacatggagtgtggtat
aatttttatacaaaagaatccgtcttcgcgctgggtaaatattacacgatgaatgcgcca
ctcgatactataccattgatgattcgcggaggatccattttaccagtacagaaaccagct
gatactacaactagcagtagaaagaataatttcgaattattgattactttggatcatgtg
aaaaaggcaaaaggcgaactatattgggatgatggcgatagtttagattcgctggagaag
gaacaatttgtatggtcagttttcaccattgagaataatactctatccgctgccaaagca
atgaagagttcttttaatgaaaaaatgatcttaggagaaatacaaatatggggaataaca
tctaatatttcacgagtatctttaaacaatcacgaaatacaatttaaatatgacagcaaa
gaaaattgtttgaacataagcaacttacaaatagacttaagagagaatttcttgctttct
tgggaatacactgattttgaacaacacgatgacagtaacaaatga

DBGET integrated database retrieval system