KEGG   Bombus impatiens (common eastern bumble bee): 100745560Help
Entry
100745560         CDS       T04362                                 

Definition
(RefSeq) pyrimidodiazepine synthase-like
  KO
K00310  pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
bim  Bombus impatiens (common eastern bumble bee)
Pathway
bim00480  Glutathione metabolism
bim00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:bim00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100745560
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100745560
Enzymes [BR:bim01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     100745560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 Glutaredoxin GST_C_3 GST_N_4
Motif
Other DBs
NCBI-GeneID: 100745560
NCBI-ProteinID: XP_012237875
LinkDB All DBs
Position
Unknown
AA seq 241 aa AA seqDB search
MSLKHLATGSVAPPIVSGKIRLYSMRFCPYAQRIHLVLDAKHIPHDVVYINLTNKPEWLL
EKSPLGKVPCIELEGGETLYESLVIAEYLDDAYPQNKLYPGNPLARAKDKLLIGRFNSVI
NTLYKLYVSTSIDRDIFDDVLSELGLFERELVSKGTPFFHGSSPGMLDFMIWPWWERSDV
VRVLRGDQFTIPRDRFKRLLEWKSAMKENPVVRASYLDTEVHAKYMRSRRAGTPQYDLIT
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgaaacacttggctaccggatcagttgccccgcccattgtatctggaaaaata
cgtttgtatagcatgcgattttgtccgtatgcccaaagaattcatttagtacttgacgcg
aaacatataccacatgatgttgtttatattaatttgacaaataaacctgaatggttacta
gaaaaaagtcctttgggcaaagttccttgtatagaattggaaggaggagaaacattatat
gaaagccttgtgattgctgaatatttggatgatgcatatccacaaaacaaactttatcct
ggtaatccccttgctagagctaaggataagttgttaattggtagatttaactctgttata
aatactttgtataagttatatgtcagtacatctatagacagagacatatttgatgatgtc
ttatcagaattgggtctttttgaaagagaacttgtatcaaaaggaacaccattctttcat
ggtagttctcctggtatgttagattttatgatatggccatggtgggagagatctgatgta
gttagagttttacgtggagatcagtttactataccacgtgataggttcaagagattgttg
gaatggaaatctgccatgaaggagaatcctgttgttcgagctagttacttagataccgaa
gtacatgctaagtacatgcgaagtcgtcgtgctggaacgccacagtacgatttaattact
gcttaa

DBGET integrated database retrieval system