KEGG   Bombus impatiens (common eastern bumble bee): 100745674
Entry
100745674         CDS       T04362                                 

Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
bim  Bombus impatiens (common eastern bumble bee)
Brite
KEGG Orthology (KO) [BR:bim00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bim04052]
    100745674
   00536 Glycosaminoglycan binding proteins [BR:bim00536]
    100745674
Cytokines and growth factors [BR:bim04052]
 Growth factors
  Growth factors (RTK binding)
   100745674
Glycosaminoglycan binding proteins [BR:bim00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   100745674
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100745674
NCBI-ProteinID: XP_024226585
LinkDB
Position
Unknown
AA seq 231 aa
MSLRWIHENLEAPTCDEECSDIDDSCSDDSYDSDLSICEEKGLGNEKEINGDRRRKRETR
RHPTTTVKFDENGTPHYITESVKRPPYVIWDPRKPAQNPVYNCLVIKLFCRTGYHLAVSN
SGRVRGLSATNEPHALLHIIPVSFGVIRIQSLETSLYLAFNKKGRLYGELSANKDNTEWE
QWNVGSYDAFRSRKYANQGWWIGIKKNGRAKPGPKTSWGQKSIQFLAIRQD
NT seq 696 nt   +upstreamnt  +downstreamnt
atgagtcttcgttggattcacgaaaacttagaagcaccaacatgcgatgaggaatgcagc
gacatcgatgacagttgcagcgacgacagctacgattccgatctatcaatctgcgaggag
aaagggctgggaaacgaaaaggagattaatggggatcgcaggaggaaaagggagaccagg
agacatccgaccactacagtgaagttcgacgagaacggaactccgcattacatcacggaa
tcggttaaacgaccgccttacgtaatatgggatcccaggaaaccagcacaaaatcctgtg
tacaattgtttggtaatcaaattgttttgtcgaaccggataccatcttgctgtttcgaac
tctggtcgagttcgaggtttgagtgccacgaacgaaccacatgctttgcttcacattata
ccggtatcatttggagtgattcgaatacaaagtcttgaaactagtctgtatttggctttc
aataagaagggacgtttatatggtgagctaagcgcaaacaaagataacacagaatgggag
caatggaacgtcggttcctacgatgcttttcgatcacgaaaatacgcgaatcagggatgg
tggataggaataaagaaaaacggacgagcaaagccaggaccaaaaacaagttggggccaa
aaatcgatacaattcttagcaatacgacaagattaa

DBGET integrated database retrieval system