KEGG   Bombus impatiens (common eastern bumble bee): 100746355
Entry
100746355         CDS       T04362                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member wengen
  KO
K16679  wengen
Organism
bim  Bombus impatiens (common eastern bumble bee)
Pathway
bim04013  MAPK signaling pathway - fly
bim04214  Apoptosis - fly
bim04215  Apoptosis - multiple species
bim04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:bim00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    100746355
   04391 Hippo signaling pathway - fly
    100746355
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    100746355
   04215 Apoptosis - multiple species
    100746355
SSDB
Motif
Pfam: TNFR_c6 Cation_ATPase_C Trp_oprn_chp Cas_CXXC_CXXC CD225 HCO3_cotransp
Other DBs
NCBI-GeneID: 100746355
NCBI-ProteinID: XP_003493418
UniProt: A0A6P3DWF3
LinkDB
Position
Unknown
AA seq 295 aa
MPREPNRAYLLAVLLLLVGLRKAGCSTSAPRYPVCKPGFEFWSVERATCWPCTRCAPEFT
LSPCAIYKDAICGPLSALELDWSFLSTRKRPETGQRSLEAVTSKMLWRFPDLDQQQIRQE
SKDFADNSQEDIQSKTKNQVLNESPYPRSAATSKERILWDWQTVALILAVCACILFFLVA
GCSALVYARQWRRMKKNFEPVGLEEISARLNLMVKAELAELVAGAPMNPGDPETRCQYLE
KLLDRKRETPVVSDWPEVSGNVYIEDGDPSKKLQIARIHRNIETMLNQKKSFSDS
NT seq 888 nt   +upstreamnt  +downstreamnt
atgcctcgggagcctaatcgggcatatctgttggccgtgttgctgctattggtcggtctc
cgcaaggctggctgctcgacatccgctccccgatatccggtctgtaaaccgggtttcgaa
ttttggtcggtcgagcgtgccacctgttggccttgcaccagatgcgctcctgaattcact
ttgagtccctgcgccatttacaaggatgctatttgcggaccgctctccgctctcgagctc
gactggtctttcctctcgaccaggaaacgaccggaaaccggccaaaggagcctcgaagcg
gttacctcgaagatgttatggaggttccccgacttggaccagcaacagattaggcaagaa
tcgaaggattttgcagacaattcgcaggaagatatccaatcgaaaacgaagaaccaggta
ttgaacgagtctccttatccaaggagcgcagctacttccaaggagagaatcctgtgggac
tggcaaacggtcgcgctgatccttgcagtgtgcgcctgtattctcttttttctggtcgca
ggatgctcggctttggtctacgcgagacagtggcgtcggatgaagaaaaacttcgagcct
gtgggtctagaagagatctcggctcgattaaatttaatggtcaaggcggaactagccgaa
ctggttgccggcgcaccaatgaaccctggtgatcccgaaacaaggtgccagtatctcgag
aaactcttagatcgaaaaagggagactcccgtggtgtccgattggccggaagtcagcggg
aacgtttacatagaagacggagatccttcgaagaaattgcaaatcgctagaattcatcga
aatatcgagacgatgttaaatcagaagaagagtttcagcgattcatag

DBGET integrated database retrieval system