KEGG   Bombus impatiens (common eastern bumble bee): 100748010Help
Entry
100748010         CDS       T04362                                 

Definition
(RefSeq) DNA ligase 1 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
bim  Bombus impatiens (common eastern bumble bee)
Pathway
bim03030  DNA replication
bim03410  Base excision repair
bim03420  Nucleotide excision repair
bim03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bim00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100748010
   03410 Base excision repair
    100748010
   03420 Nucleotide excision repair
    100748010
   03430 Mismatch repair
    100748010
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bim03032]
    100748010
   03400 DNA repair and recombination proteins [BR:bim03400]
    100748010
Enzymes [BR:bim01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100748010
    6.5.1.6  DNA ligase (ATP or NAD+)
     100748010
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     100748010
DNA replication proteins [BR:bim03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    100748010
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     100748010
DNA repair and recombination proteins [BR:bim03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     100748010
   NER (nucleotide excision repair)
    Other NER factors
     100748010
   MMR (mismatch excision repair)
    Other MMR factors
     100748010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C mRNA_cap_enzyme FKS1_dom1
Motif
Other DBs
NCBI-GeneID: 100748010
NCBI-ProteinID: XP_012241007
LinkDB All DBs
Position
Unknown
AA seq 954 aa AA seqDB search
MYTRIAFNLRSIVFNNTYSRPVIFLSKQFQLNNAFSPIVNNVLNRILANSKIVKNGDQSN
SGNPKRKRDDSGDSSETASPPIGNSSRKKSVSKSPSPLKKVNGTPKIKLSPITTTKEKEK
RKSKTPHTATKKKRKTNEVKSTPKKSDTKKKLKDVSSDEDQKENELTVEKKTETSDEFES
SKSSPKESKTKKNVKSSEKKATKKRSRIIAPVDSSDEEEHNLLPESPKKANLDVEENNPV
NEEENSDEDVLDNQKGSEEEEKKKEDNVEKPAKKIHNFLAPKKKESTNNTDKDKKKSSSH
SYKPSASKYDPINDAFWKQGEKVPYIALTRTLELIEDTSARLKIIEILSNYFRSVIVLSP
DDLLPSIYLCLNQLAPAYEGIELGVAETNLMKAIAQCTGRTLAQIKADVQTVGDLGIVAE
GSRSNQRTMFQPAPLTVSIVYTRLKEIAQMTGSASLTKKLDKIQSLFVACRFTEARYLIR
SLAGKLRIGLAEQSVLQALALACTMTPPIQSYPPEVLDVSKKMSSDAFKQKYDETALTLK
TTYCECPNYDKIIPVLLKEGIEELPNKCKITPGIPMKPMLAHPTKGVQEVLTRFDGLKFT
CEWKYDGERAQIHLAEDGKISIYSRNQENNTSKYPDIIGRFKNTQGEEVKSCILDCEAVA
WDNENKQILPFQILSTRKRKDANEADIKVQVCVFMFDLLYLNGEPLVQQPFIKRRELLKK
NFKEVIGEWKFATSLDTSTMEQVQDFLDESVKGNCEGLMVKTLEQDATYEIAKRSRNWLK
LKKDYLEGVGDTLDVVVIGGYIGKGKRTGTYGGFLLACYDQENEEYQSVCKIGTGFSEED
LQKHTEFFKEHIIPQTKSYYRYDSSLEPDHWFEPVQVWEIKCADLSLSPVHKAAVGIIDP
EKGISLRFPRFVRIRDDKNNEDATSAQQVANMYNSQEQIKNQTSSTKVAEEDFY
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgtatactcgtattgcgttcaatttgagatcaattgtatttaataatacttattcgcga
cctgtgatatttttaagtaaacaattccaattgaataatgctttttcccctattgtaaat
aatgttcttaatcggatactcgctaatagcaaaattgtaaagaatggagaccaaagcaat
tcgggtaaccctaaacgaaaaagagacgatagtggagatagcagtgaaactgccagtcca
cctattggaaattcctcaaggaagaaatcagtctcaaaatctccgtcaccactaaagaaa
gtaaatggaacaccaaaaattaagctatcaccaataacgacaactaaggaaaaggaaaaa
agaaaaagtaaaactccacatactgctactaaaaagaaaagaaaaaccaatgaagtaaaa
agtacccctaagaagagcgatacaaagaagaaattgaaagatgtgtcaagtgatgaggac
cagaaagaaaatgagttgactgtagaaaagaaaacagaaacaagtgatgaatttgaatct
tcaaagtcttcgcctaaggaatctaaaactaaaaagaatgttaaaagtagtgaaaaaaaa
gctactaaaaagaggtcaaggataatagcacctgttgattccagtgacgaagaagaacat
aatctgttgccagaaagtcccaaaaaagcaaatcttgatgtggaggaaaataacccagtt
aacgaagaagaaaattctgacgaggatgttctagataatcaaaaaggcagtgaagaagaa
gaaaagaaaaaagaggataatgtagagaagcctgcgaaaaagatacataattttcttgct
ccaaaaaagaaagaaagtacaaataatactgataaagataagaaaaagtcttccagtcac
tcatataaacctagtgcctcgaaatatgacccaataaatgatgcattttggaaacaggga
gaaaaggtaccatatattgcgttgacacgtacgttggaattgatcgaagatacaagcgct
cgattaaaaataatagaaattttatcaaattatttccgatctgtaatagttttaagccca
gatgacttacttccaagcatatatttatgtctcaatcaattagcacctgcttatgaaggg
attgaattaggggtggcagaaacaaatttgatgaaagctatagcgcaatgtactggtaga
acattagctcaaattaaagcagacgtccaaacagttggggatttaggcatcgtggcagaa
ggaagtcgttccaatcaaagaactatgtttcaacctgctccactgacagtatcgattgta
tatactaggctgaaagagatcgcacaaatgactggttctgcgtctttaactaaaaaattg
gataaaattcaatcgctttttgtagcgtgtcgttttaccgaagccagatatctcattcgg
tcgctagccggcaaacttcgaattggtctagcggaacaatctgtgttacaagctttggca
ctagcgtgtactatgacaccaccaatacaaagttatccaccggaagttttagacgtgagt
aagaaaatgtcaagcgatgcctttaaacaaaagtacgacgaaactgcgcttactcttaaa
acaacatattgtgaatgtccaaattatgacaaaataattcctgttttactaaaagaaggg
attgaagaattaccgaacaaatgtaaaattacacctggcatacctatgaaaccaatgttg
gcacatcctactaaaggtgtgcaagaagtattaacgcgtttcgatggattgaaatttact
tgtgaatggaagtacgatggagaaagagcacagattcatttagccgaggatggtaaaatt
agtatttacagtaggaatcaagaaaataataccagcaaatatcctgatattataggaaga
tttaaaaatactcaaggcgaagaagttaaaagttgtatccttgactgtgaagcagtagcc
tgggataacgagaataaacaaatcctacctttccaaatactcagtacaagaaaacgcaag
gatgcgaacgaagcagatattaaagttcaagtatgtgtgttcatgtttgatttgttgtat
ttaaatggagaaccactggtacaacaacctttcataaaacgtcgtgaattattgaaaaag
aatttcaaagaagtaattggagaatggaaatttgcaactagtttagatacttcgactatg
gaacaagtgcaagatttcttagatgaatcagtcaaaggcaattgcgagggccttatggtg
aagaccttagaacaggatgcaacatatgagattgctaagcgttctcggaattggttaaaa
ttgaagaaagattatttagaaggtgtgggcgatacattagacgtggttgtcattggtggc
tatatagggaaaggaaaaaggacaggaacctatggaggatttcttttagcttgttatgat
caagagaatgaggaatatcaaagtgtttgtaagattggtactggattcagcgaagaagac
cttcaaaagcacacagagttcttcaaagaacatataataccacaaactaagtcctactat
cgttatgactcgtctctcgaacctgatcactggttcgaaccagttcaagtgtgggaaatt
aaatgtgcagatctttctttgtcacctgttcataaggcagccgttggtattattgatcca
gagaaaggaatatctttgcgatttccacgttttgtccgcattcgcgatgataaaaacaac
gaggatgctacctcagcgcaacaagttgcaaatatgtacaacagtcaagagcagataaaa
aatcagacatcatcaacaaaagtagctgaagaagacttttattga

DBGET integrated database retrieval system