KEGG   Bombus impatiens (common eastern bumble bee): 100748641Help
Entry
100748641         CDS       T04362                                 

Definition
(RefSeq) DNA ligase 3 isoform X1
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
bim  Bombus impatiens (common eastern bumble bee)
Pathway
bim03410  Base excision repair
Module
bim_M00296  BER complex
Brite
KEGG Orthology (KO) [BR:bim00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    100748641
Enzymes [BR:bim01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100748641
DNA repair and recombination proteins [BR:bim03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     100748641
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C zf-PARP RNA_ligase BRCT_2 CbiK LIG3_BRCT Cytomega_gL HD_2
Motif
Other DBs
NCBI-GeneID: 100748641
NCBI-ProteinID: XP_003488227
LinkDB All DBs
Position
Unknown
AA seq 1024 aa AA seqDB search
MSMSDEEKEEEKPFAVERAKSGRAKCKKCKCPIEKDTVRIAKLVANPFSDGKMKAWHHLS
CLFEVFARQRATTKRIDDPEEDVSGWQDLCDEDKTAILQRIEEFENSSPFKTPKTTQVAN
QSSGSKKRKLTRTTESDPSPNKKPRKKERNGSTCTIDDASDISGSEKTPEKVRKPTRDDA
FQEFQRICDNVAKVDAYTDKTAILRKMLTKGSEGDGFNSDVKLWCKMLLPGTAKRIYNLQ
SKQLVKLFSRILLQDEDEMLEHLEQGDVSETIRVFFENSVALKPALKSVLTIQEVDEFLQ
QLSLLTKEDEQIRHFRSIVSRCTAGDLKMIIRLIKHDLRINAGPKHILAAVHDDAYKAFQ
TSRDLDSVIERCWRGSPKFDKPSSSPGPSSNVKITLSLMTPVLPMLAEACKSVEMAMKKC
PNGMLAEVKYDGERVQVHKKGNEFRYFSRSLKPVLPHKVNLFKNYIPKAFPDGDDLILDS
EILMIDTKTGQPLPFGTLGIHKKAEFKDANACLFVFDCIYYNGVVLLHKSMMERRQILRE
SMTEIPNRIMLSEIKEVYKSQDLAEMIARVLKMGLEGLVLKDIHSKYEPGKRHWLKVKKD
YLYDGAMADSADLVVLGAWYGTGNKGGMMSVFLMGCYDEDRGNWVTVTKVHTGHDDATLV
MLQDELDMIKISKDPAKVPSWLRANKPMIPDFVAKDPKKQPVWEITGAEFTNQGVHTADG
ISIRFPRVTRIRSDKDWSSATTLNDLRRLFKQSSESIDLSLLLSSTSDHKEEGDDKTTRQ
DTLPNAQAKQERKLKSPSKRNDDFKSIKKNSSPYKSPTKSKATSNRVRADTSKKTNEKVC
DSEGTNVSDQKDAEQAEFYAFVNNDYIEYSAMGIPLNWIEGRKPENGLPSDAKPLCNLTD
NELTSKSILKGAPVSLASGFTKSKEEDIRKLLKTLGAKVLNDQERSAAMYVVHSSKEIPS
SLVREFEDVSKKARHVSVSWVEAVVSTCEIQETEEHAVELIADYCSCPCLHRFSAFVCCI
RISM
NT seq 3075 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatgtcggacgaggagaaggaagaggagaagccgttcgcggtggaacgggcaaaa
agcggtcgcgccaagtgcaaaaaatgcaagtgccccatagaaaaggacaccgtaaggatc
gcgaagctagtcgcgaatccgttctccgatggcaaaatgaaagcttggcatcacttgagc
tgtctgttcgaggtgttcgccagacaaagggctaccaccaagagaatagacgatcccgag
gaagatgtaagcggctggcaggatctgtgcgacgaggacaaaactgcgattcttcaaaga
atcgaggagtttgaaaactcgtctccgttcaagactccgaagacgacacaggtcgcgaat
caatcctccggctcgaagaaacgcaaacttactcgtacgacggagtctgatccttctcct
aacaaaaaaccgaggaagaaagagaggaatggctccacgtgcaccatcgacgacgcatcg
gatatctcaggatcggaaaagacgcccgagaaggtgcgaaaaccgacgagagacgacgcg
tttcaggaatttcagcggatctgcgataacgtggccaaagtcgacgcctacaccgacaag
acggcgattctaagaaagatgctaaccaaagggtccgaaggtgatggtttcaacagcgac
gtaaagctgtggtgcaaaatgctgcttccggggacagcgaagaggatatacaacttgcag
agcaaacaattggtaaagctgttctctcgtatcctgcttcaggacgaggacgagatgttg
gagcatctcgagcaaggagacgtgagcgaaaccatccgggtgtttttcgaaaacagcgta
gctttaaaaccagctctaaaaagcgtacttacgattcaagaggtggacgagtttctgcag
cagttgtcgcttctaactaaggaggatgaacagattcgtcactttcgttcgatcgtttcc
agatgcaccgcaggcgatctaaagatgatcatccggctgatcaagcacgatctaaggata
aacgctggcccgaaacatattttggccgcggtacacgatgacgcgtacaaagcctttcaa
acgtccagggacttggacagcgtgatcgaacgatgttggcgaggatccccgaaattcgat
aaaccgtcttcgtcgccgggtccatcttccaacgttaagattacgctctcgctgatgaca
cctgtcttgccgatgttggcggaggcttgcaaatccgtggaaatggcgatgaagaaatgc
ccgaatggaatgctggccgaagtgaaatacgacggagaacgggtgcaagtgcataaaaag
ggaaacgaatttcgctatttcagcagatccttaaaaccggtgcttcctcataaagtgaat
ctcttcaagaattacattccgaaagcctttccagacggcgatgacttgattctagactca
gagatcctcatgatagataccaaaactgggcaaccattaccctttggtaccttaggcatt
cataagaaagccgaattcaaggatgccaatgcctgcttatttgtcttcgattgtatctat
tataacggggttgttttgttgcataaatccatgatggaacgaagacaaattttaagagaa
agtatgacggagataccaaacaggataatgctgtcggaaatcaaggaagtctataaatct
caagacttggcagaaatgattgccagggttcttaaaatgggcctcgaaggattggtgctt
aaggacatccacagcaaatacgagccgggtaaaagacattggttgaaggtaaaaaaggat
tatttatacgatggtgcgatggccgatagcgcagatctcgttgtgcttggcgcatggtac
ggcacgggaaacaaaggtggtatgatgtcggtattcctgatgggctgctacgacgaagat
cgtggtaactgggtaacagtaacaaaagtacacaccggtcacgacgacgcgaccttagtc
atgcttcaggatgagctcgatatgataaaaataagtaaagatccggccaaagtaccgtcc
tggttgcgcgccaataaaccaatgattcctgactttgtcgcaaaggatccaaagaaacag
ccagtgtgggaaataacgggagcagaatttaccaatcaaggtgttcacacagctgacggt
attagtattagatttccacgggtaacgcgtattcgttctgataaagattggtcttccgct
actactttgaacgatttgcgacgtcttttcaagcagagttccgagtcgatagatcttagc
cttcttttgtcttcgacctctgaccataaggaagaaggtgacgataagacaaccagacag
gataccttaccaaatgcacaggcgaaacaggaaagaaaattaaagtctccgtcgaaaaga
aacgacgatttcaaatcgatcaagaagaattcctctccgtacaagtctcccacaaaatca
aaagccacctctaatcgtgtaagagccgatactagcaaaaaaacgaacgaaaaagtatgc
gacagcgaaggaaccaatgtctcggatcaaaaggacgcggaacaagcagaattttatgct
ttcgtaaataacgattatatagaatattctgccatgggaattccactaaattggatcgag
ggacgaaagccagaaaacggacttccgtcggatgcgaagccattatgtaatctaacagat
aacgaattgacgtctaagagtattttaaagggcgcgccagtcagtttagcgtcaggtttt
acaaaaagcaaggaagaagacattcgcaagttactcaaaactctcggagccaaggtgttg
aacgatcaggaaagatccgcggccatgtacgtggttcattcttccaaggagattccgtca
tcccttgtgcgcgagttcgaggacgtgtcaaagaaggcaagacacgtaagtgtctcttgg
gtagaggcagttgtctcgacgtgcgaaattcaagaaacggaagagcatgcggtagaactg
atcgccgattactgttcttgtccctgtttacatcggttctcggcattcgtttgctgcatc
cgtatcagcatgtag

DBGET integrated database retrieval system