KEGG   Bombus impatiens (common eastern bumble bee): 100749266Help
Entry
100749266         CDS       T04362                                 

Definition
(RefSeq) maltase 2-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
bim  Bombus impatiens (common eastern bumble bee)
Pathway
bim00052  Galactose metabolism
bim00500  Starch and sucrose metabolism
bim01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100749266
   00500 Starch and sucrose metabolism
    100749266
Enzymes [BR:bim01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100749266
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase Malt_amylase_C
Motif
Other DBs
NCBI-GeneID: 100749266
NCBI-ProteinID: XP_003493603
LinkDB All DBs
Position
Unknown
AA seq 574 aa AA seqDB search
MFRLTIVTCSLLFALSAGVDVDWYKNIIVYQVYPRSFKDSNGDGIGDLNGITSKLEHVKD
IGAKVVWLSPIYKSPQVDFGYDISNFTDIDPDYGTLADFDKLVTKAKSLGLKVVMDFVPN
HSSNDHPWFKKSIQRIKPYDEYYVWHDGRIVNGTRLPPNNWLSNFQGSAWQWNDVRKQYY
LHQFAAGQPDLNYRSQALDQEMKNVLTFWMNRGVDGFRIDAINHMFEDAKFRDEPSANRT
DVPKDDYDSLVHIYTKDQNETYETLRSWRELMDEHSNRTRSDPKLILTEAYTTHDLTTKF
YSAGSNVPFNFMFITELNNKSTAMDYKNLIDKWVNTVPQGSVPNWVVGNHDNHRVASRFG
RRRADEITEMALILPGIAVVYNGDEIGMIDRQFTYAETVDPAGCNAGPARYFLKSRDPER
TPYQWDNSTSAGFSTSAKTWLPVHPNYKTLNLEAQKELYYSHYQVFKSVMSVKRRPVIAH
GSLNVTVYDQRVLSITRTLGNDTVIVMFNFANVPVTVNARAALPLSPTLIVHTVSVGPNL
RPGTTVFTNSITIPASATVMYTTPNIFWSKDEYV
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgactaacgattgtaacgtgttccttgctattcgcgctaagcgcgggagtggat
gtggattggtacaaaaatatcatcgtgtaccaagtctatccgaggagtttcaaagacagc
aatggagatggtatcggtgacctgaatggtatcaccagcaaactggaacacgttaaggac
attggtgctaaggtcgtctggctatcgccgatctataagagtccacaagttgatttcggt
tacgacatctccaactttacggacattgatccagattatggaactttagcggatttcgac
aaattggtaactaaagctaagtccctcgggctcaaagtggtcatggacttcgtgcctaat
catagctctaacgatcatccctggttcaaaaagagtattcaaaggatcaagccgtacgat
gaatactacgtctggcacgatggcagaatcgtaaatggcaccagactgccgccaaacaac
tggctgagcaacttccagggatctgcctggcagtggaacgacgtccgcaagcagtattac
ctacatcagtttgctgcaggtcagccagatttgaattatcgcagtcaggctttagatcag
gaaatgaaaaacgtgttgactttctggatgaatcgcggagtcgacggtttccgcattgac
gctatcaatcatatgttcgaggatgccaagttccgcgacgagccgagcgcaaacaggacc
gatgtccctaaagacgattacgatagcctggtgcatatttacacgaaagatcagaatgag
acctacgagacgctccggagctggagggaactgatggatgaacactccaaccgtacccga
tccgatccaaagttgattctcacggaagcctatactactcatgacctaaccactaaattc
tacagtgctggctccaatgttcccttcaactttatgtttattacagaactgaacaacaaa
tctaccgcaatggactataaaaatctgatagacaagtgggtcaataccgtgcctcagggt
agcgtgccgaactgggtcgtgggcaatcacgataatcatcgtgtggcctctagattcgga
agacgacgagctgatgagattaccgaaatggcgctgatcctacctggcatagcggttgtt
tacaacggtgatgaaatcggaatgatagacagacaattcacgtacgccgaaactgttgat
ccagctggttgcaacgctggtcccgccagatactttctgaaatccagagatcccgaaaga
acaccgtaccaatgggacaacagcaccagtgctggattctccaccagtgcgaaaacctgg
ctgcccgtgcatccaaattacaagaccctgaacctggaagctcagaaggagctatattac
tctcactaccaggtattcaaaagtgtgatgagcgtgaaaaggcgaccagtcatcgcacac
ggttccttaaacgttaccgtatacgaccaaagggttttgagtattactcgcactctagga
aatgacactgtaattgttatgtttaattttgccaatgtacctgtcaccgtaaatgctaga
gctgccctgccactttctcctactctgatagttcataccgtcagcgttggtcccaatctt
cgcccaggtaccaccgtcttcacaaattcgataactattcctgcatctgctactgtcatg
tatactactcctaatatattttggtcaaaggatgagtatgtttga

DBGET integrated database retrieval system