KEGG   Brachyspira intermedia: Bint_2272Help
Entry
Bint_2272         CDS       T01847                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
bip  Brachyspira intermedia
Pathway
bip00500  Starch and sucrose metabolism
bip01100  Metabolic pathways
bip01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bint_2272
Enzymes [BR:bip01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Bint_2272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase Capsule_synth
Motif
Other DBs
NCBI-ProteinID: AEM22878
UniProt: G0EMA7
LinkDB All DBs
Position
2601212..2603773
Genome map
AA seq 853 aa AA seqDB search
MKLNKYMVSPSVPKELEPLIEITKNFWWCWNQKAVTLLRTIDIDNWDKRDHNPIRVLGES
LQERFDAMLQDDAAMMNLAEVYDEFKTYMKQETWYNSLDDSQKTPNEKIAYFSFEYGLHE
SLPNYSGGLGILSGDHLKSASDLGLPLVAVGLLYRKGYFRQYLNADGWQQEYDIENDFFN
LALEKVLDKNGETMKVDVDLPGRKVYAQIWKANVGRIELYYLDANIEENRIEDRDITAQL
YGGNLETRIQQEILLGIGGVKALEKLGIKPTIYHMNEGHSAFLSLERIRQLMENNHLDKN
TAREVVFSSNIFTTHTPVPAGNDIFPIDMIQKYFTDYVKHIDMTMDEFIRLGRINPDDQK
ESFCMTVLALNLSAENNGVSELHGHVSRAMWKDIWKGVPVNELPIDSITNGIHTLSWISF
DMQNLLDRYLGPRWRTKPLEYEIWERVQKIPDAELWRTHERRKERLIDFCRERLKTQITN
RGFTKSEIEHADQILSPEALTIGFARRFATYKRGTLLFRDLERLKKIVTNSERPVQIIFA
GKAHPHDNGGKELIRNIAEICRREDFRDHIVFIEDYDINVARYMVQGVDVWLNNPRRPLE
ASGTSGMKVPPNGGLNFSVLDGWWDEAYDGQNGWPIGNREEYTDLEYQDEVESKALYNVL
ENEIIPLFYERGRDNIPRQWVAAMKWSMQTVCPVFSTNRMVADYFHKFYNNASRRYFNMT
ENEFAKAKELKAWKQDIASKWSKVLIENTISEMPSRNLKVGSKFEVKTIVNLGDIAPDSV
RVELYHGKLSMKEEIIDPITVEMKHSADLGNGRHSFSGTLECTNSGQSGYAIRMYPYHKD
LSYKFDMKLIIWS
NT seq 2562 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaataaatatatggtttcaccatcggttccaaaagaattagaaccacttata
gaaattactaaaaacttttggtggtgctggaatcagaaagcagtaactttattaagaaca
atagatattgataattgggataaaagagatcataatcctataagagtgttgggagaatct
cttcaagaacgttttgatgctatgcttcaagatgatgcggctatgatgaatttagctgaa
gtttatgatgagtttaaaacttatatgaagcaggaaacttggtataatagtttagacgat
agccaaaaaactcctaatgaaaaaatagcttatttctcttttgaatatggtttgcatgaa
tctctacctaactactcaggaggtcttggtatattatcaggagaccatttaaaatctgct
agtgatttgggtttgccattagtagcagttggacttttatatagaaaaggatatttcaga
caatatttaaatgctgatggttggcagcaggaatatgatatagaaaatgatttctttaac
ttggctttagaaaaagttttagataaaaacggcgaaactatgaaagtagatgttgatctg
cctggaagaaaagtttatgctcaaatttggaaagctaatgtaggaagaatagaactttat
tacttagatgctaatatagaagaaaatagaattgaagacagagacattactgctcagctt
tacggcggtaatttagaaactagaatacagcaggaaatacttcttggtataggaggtgtt
aaggctttagagaaattaggaattaaacctactatataccatatgaacgaaggtcacagt
gctttcctttctttagagagaataagacaattaatggaaaataatcatttagataaaaat
acagcaagagaagttgtatttagttctaatatatttacaactcatactcctgtacctgct
ggtaatgatatattccctatagatatgattcagaagtatttcactgattatgttaaacat
atagatatgactatggatgaattcataagacttggaagaatcaatccagatgatcaaaaa
gaaagtttctgtatgacagtacttgctcttaacctttctgctgaaaataacggtgttagt
gaacttcatggacatgtatcaagagctatgtggaaagatatttggaaaggtgttcctgtt
aatgagcttcctatagattctattactaatggaattcatactttaagctggatatctttt
gatatgcaaaacttattagacagatatttaggacctcgttggagaactaaacctttagaa
tatgaaatttgggaaagagttcaaaaaatacctgatgcagaactttggagaactcatgaa
agaagaaaagaaagacttattgacttctgtagagaaagattaaaaactcaaataacaaac
agaggattcacaaaaagcgaaatagaacatgctgatcagatactttctcctgaagcttta
acaataggttttgctagaagatttgctacttataaaagaggtacattgcttttcagagat
ttagagagattaaagaaaatagttactaattctgaaagacctgtacaaatcatatttgct
ggtaaagctcacccacatgataatggcggtaaagaattaataagaaatattgctgaaatt
tgcagaagagaagatttcagagatcatatagtatttatagaagactatgatataaatgtt
gctagatatatggtacaaggtgttgatgtatggcttaataaccctagaagacctttagag
gcaagcggtacaagcggaatgaaagtaccaccaaatggaggtttaaacttcagtgtatta
gacggatggtgggacgaagcttatgatggtcaaaatggatggcctattggtaacagagaa
gaatatactgacttagaatatcaagatgaagttgaaagtaaagctctttataatgtttta
gaaaatgaaataatacctctattctatgaaagaggaagagataatattcctagacaatgg
gttgctgctatgaaatggagtatgcaaactgtttgtcctgtattctctactaatagaatg
gttgctgattatttccataaattctataacaacgcaagcagaagatatttcaatatgact
gaaaatgaatttgctaaagctaaagaattaaaagcttggaaacaagatatagcttcaaaa
tggtcaaaagttcttattgaaaacacaatttctgaaatgccttcaagaaatttaaaagtt
ggaagcaaatttgaagttaaaactatagttaatcttggagatatagctcctgattctgta
agagtagaactttaccatggtaagttaagcatgaaagaagaaattatagatcctattaca
gttgaaatgaaacattctgctgatttaggaaacggaagacattctttctcaggaacttta
gaatgtactaacagtggacaaagcggttatgctataagaatgtatccatatcataaagat
ttaagctataaatttgatatgaaacttattatatggagctaa

DBGET integrated database retrieval system