KEGG   Bacillus inaquosorum: AN935_05070
Entry
AN935_05070       CDS       T07179                                 

Name
(GenBank) hypothetical protein
Organism
biq  Bacillus inaquosorum
SSDB
Other DBs
NCBI-ProteinID: AMA51666
LinkDB
Position
1029324..1029485
AA seq 53 aa
MFIKQFHIGAANPMFCLIERFFWSSRALKSAVHIISVRKGMELTLHAFFIYKI
NT seq 162 nt   +upstreamnt  +downstreamnt
gtgtttatcaaacagtttcatattggcgcggcaaaccctatgttctgtttaattgaacgg
tttttttggtcgagccgcgcgctgaaaagcgctgtgcatatcatatcggttagaaaaggc
atggagctgacgcttcatgccttttttatatacaaaatctaa

DBGET integrated database retrieval system