KEGG   Bacteroides intestinalis: DXK01_004015Help
Entry
DXK01_004015      CDS       T06090                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bis  Bacteroides intestinalis
Brite
KEGG Orthology (KO) [BR:bis00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DXK01_004015 (ahpF)
Enzymes [BR:bis01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DXK01_004015 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 GIDA HI0933_like FAD_oxidored Thioredoxin_3 FAD_binding_2 NAD_binding_8 Thi4 DAO AlaDh_PNT_C NAD_binding_7 FAD_binding_3 Lycopene_cycl K_oxygenase
Motif
Other DBs
NCBI-ProteinID: QDO68139
LinkDB All DBs
Position
1147790..1149349
Genome map
AA seq 519 aa AA seqDB search
MLETSILNQVRSVFQNLEAQYTFHITCHPRHGNAQELTELLKDVAGCSDKLSCEVTETEE
PKLEFSLLKNGKETGVKFRGIPNGHEFTSLLLAILNADGKGKNLPDKAIRRRIQALKGPI
SLQTYVSLTCTNCPDVVQALNIIALLNRQVTHEMIDGALFQEEVDALKIQGVPSVYANGK
LLHVGRGTLGELLQKLEEMFGSEPVGNAEPISRTYDVLVLGGGPAGASAAIYSARKGLRV
AIVAEKIGGQVKETVGIENLISVPQTTGAQLADNLRSHINHYPIDLFEDRKIEKAELQGK
EKRISVVGGEAFISPSVIIATGASWRKLNVEGETEYIGRGVAFCPHCDGPFYQGKDIAVI
GGGNSGIEAAIDLAGICRKVTVFEFADTLKADQVLQEKAQSLPNVEIFTSSQTTKVVGNG
DKVTAIRVKDRVSSEERDFPLDGIFVQIGLAANSAPFRDMLETTPIGEIKIDAFCRTTLP
GVYAAGDVSDVPYKQIVIAMGEGAKAALSAFDDRIRGIA
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaacaagcattttaaatcaagtacgcagtgtcttccaaaacctagaagcacag
tacacttttcatatcacctgccatccccggcacggaaacgcacaggagctgacagagttg
ctgaaagatgtagcaggatgttccgataaactctcctgtgaggtaactgaaaccgaagaa
ccgaagctggaattctctttactgaaaaacgggaaagaaaccggtgtcaaattccgcggg
ataccgaacggccatgaattcacatctttgcttctggcaatactgaatgccgatggaaag
gggaaaaatcttcccgataaagccatccgccgacgcattcaggcgttgaaaggacccatt
tcattgcagacttatgtatcattgacatgtaccaactgccccgatgtggtgcaggctctg
aacataatagctctgctgaacagacaggtcacacatgaaatgatagacggtgcccttttc
caggaagaagtggatgcactgaaaattcaaggcgtaccgtccgtctatgccaacggtaaa
ttgcttcatgtaggacgtggcactttaggcgaacttctgcaaaagctggaagaaatgttc
ggttccgaaccggtagggaatgcagagcctatctcacgtacttatgatgtcctcgtatta
ggtggcggaccggcaggtgcctcagccgcaatctattcagcccgtaagggattacgggta
gccattgtagccgaaaagatcggtggtcaggtaaaggaaaccgtaggaatcgagaacctg
atctccgtgccacagactacaggtgcacagttagcagacaatttaagaagccatatcaat
cattatcccatcgacttgtttgaagaccgtaagatagagaaggcggaacttcaaggaaaa
gaaaagaggatttcagtagtgggcggtgaagcattcatatctcccagtgtaataattgcc
accggtgcaagctggcgcaaactgaatgtggaaggtgaaacggaatatataggcagagga
gttgccttctgtccgcattgcgacggaccgttctatcaggggaaagatatagccgttatc
ggtggcggaaactccggtatagaagcagccatcgacttggcgggtatctgccggaaagtg
actgtctttgaatttgccgatacgctgaaagccgaccaggtattgcaagaaaaggcgcaa
agcttaccgaatgtagaaatcttcacttcctcgcagactaccaaagtagtgggaaacggt
gataaggtaacagctatccgcgtcaaagaccgtgtaagtagtgaagaacgggatttccca
ttggatggtatcttcgtacaaattggcctggcagctaatagtgctcctttccgtgacatg
ctggagacgacaccaataggcgaaatcaagatcgatgctttttgccgcaccacgcttccg
ggcgtttatgcagcaggagatgtttcggacgttccctacaaacagatagtaattgcaatg
ggtgaaggtgcgaaggcggcactgtcggcatttgatgaccgcatccggggaattgcataa

DBGET integrated database retrieval system