KEGG   Bacillus intestinalis: BIS30_02900
Entry
BIS30_02900       CDS       T05513                                 

Definition
(GenBank) PTS system fructose-specific transporter subunits IIA
  KO
K11194  fructose PTS system EIIA component [EC:2.7.1.202]
Organism
bit  Bacillus intestinalis
Pathway
bit00051  Fructose and mannose metabolism
bit02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BIS30_02900
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BIS30_02900
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bit02000]
    BIS30_02900
Enzymes [BR:bit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     BIS30_02900
Transporters [BR:bit02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BIS30_02900
SSDB
Motif
Pfam: EIIA-man Phage_tail_APC
Other DBs
NCBI-ProteinID: AJW84202
LinkDB
Position
complement(499700..500140)
AA seq 146 aa
MISVIISGHGDFPIALKESSGMIFGEENNLLAVPFFKGEGIQTLQEKYRQALKDIPEENE
VLFLVDIFGGTPYNAAASLIAEDQRMDMAAGVNLPILLEVLSLREHLALKDLLNNLKTMS
RKSFQVCSEHLEKVKTANQETREDEL
NT seq 441 nt   +upstreamnt  +downstreamnt
atgatttcagttattatcagcggtcatggagattttcccatagcattaaaagagtcttca
gggatgatattcggtgaagaaaataacctgcttgcagtgccgttttttaaaggggaaggc
attcaaacgctgcaagaaaaatatcgtcaggcgctcaaggacattccggaagaaaatgaa
gtgctttttttagtcgatatttttggaggaacgccatataacgcggcagcttctttaatt
gctgaggatcaaagaatggatatggcagccggcgtaaacctgccgattctgctggaggta
ttaagcctgagagaacatctggcacttaaagatttgctgaacaacttaaaaacaatgagc
cggaaaagttttcaagtgtgcagtgaacatttagaaaaagtaaaaacagccaatcaagaa
acaagagaggatgaattgtga

DBGET integrated database retrieval system