KEGG   Bacillus intestinalis: BIS30_03190Help
Entry
BIS30_03190       CDS       T05513                                 

Definition
(GenBank) D-tyrosyl-tRNA(Tyr) deacylase
  KO
K07560  D-aminoacyl-tRNA deacylase [EC:3.1.1.96]
Organism
bit  Bacillus intestinalis
Brite
KEGG Orthology (KO) [BR:bit00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bit03016]
    BIS30_03190
Enzymes [BR:bit01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.96  D-aminoacyl-tRNA deacylase
     BIS30_03190
Transfer RNA biogenesis [BR:bit03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Trans-editing factors
    BIS30_03190
 Prokaryotic type
    BIS30_03190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tyr_Deacylase VID27_N
Motif
Other DBs
NCBI-ProteinID: AJW84256
LinkDB All DBs
Position
complement(556856..557296)
Genome map
AA seq 146 aa AA seqDB search
MKLVVQRVTEASVTVDEEVVGQIGQGIMVLVGITHDDTEEDAAYLADKVVHLRIFDDSEG
KMNLSLLDIGGEILSVSQFTLYGDTRKGRRPNYMNAAKPDKALGLYEKWNDLLREKGIKV
ETGTFGAMMDVQLTNSGPVTLIMDSK
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagttgttcagcgagtaacagaagcaagcgttacagtggatgaagaggtcgtc
ggccaaattggacaaggcatcatggtgctggtcggcatcactcacgatgatacagaagag
gatgcagcttatttagccgataaagttgtacatcttcgtattttcgatgacagtgaagga
aaaatgaatctgtctcttttagatataggaggagagattttatctgtctcacagtttacg
ctttacggagatacgagaaaagggcgccgtccgaactacatgaacgccgccaaacctgat
aaagctttaggtctttatgaaaaatggaacgacctgcttcgcgaaaaaggaatcaaagtc
gagaccggaacgtttggagcgatgatggatgttcagcttacaaactccggacccgtcacg
ctcattatggattcaaaataa

DBGET integrated database retrieval system