KEGG   Bacillus intestinalis: BIS30_04000Help
Entry
BIS30_04000       CDS       T05513                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bit  Bacillus intestinalis
Pathway
bit00020  Citrate cycle (TCA cycle)
bit00480  Glutathione metabolism
bit01100  Metabolic pathways
bit01110  Biosynthesis of secondary metabolites
bit01120  Microbial metabolism in diverse environments
bit01130  Biosynthesis of antibiotics
bit01200  Carbon metabolism
bit01210  2-Oxocarboxylic acid metabolism
bit01230  Biosynthesis of amino acids
Module
bit_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bit_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BIS30_04000
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BIS30_04000
Enzymes [BR:bit01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BIS30_04000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AJW84402
UniProt: A0A1V4FZQ8
LinkDB All DBs
Position
complement(720802..722073)
Genome map
AA seq 423 aa AA seqDB search
MAQGEKITVSNGVLNVPNNPIIPFIEGDGTGPDIWNSASKVLEAAVEKAYKGEKKITWKE
VYAGEKAYNKTGEWLPAETLDVIREYFIAIKGPLTTPVGGGIRSLNVALRQELDLFVCLR
PVRYFTGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGSEEVQKLISFLQNELNVNKIR
FPETSGIGIKPVSEEGTSRLVRAAIDYAIEHGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EREYGEKVFTWAQYDRIAEEQGKDAANKAQSEAEAAGKIIVKDSIADIFLQQILTRPNEF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVLLLEHLGWNEAADLVIKSMEKTIASKVVTYDFARLMDGATEVKCSEFGEELIK
NMD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtggcacaaggtgaaaaaattacagtttctaatggagtattaaacgtaccaaacaacccg
attatcccgtttatcgaaggagacggaaccggtcctgatatttggaactcggcttcgaaa
gttttggaagcagcagttgaaaaagcatacaaaggcgaaaagaaaattacgtggaaagaa
gtttatgccggagaaaaggcttataataaaacaggtgagtggctgcctgctgaaacatta
gatgttatccgcgaatatttcatcgcgattaaaggcccgttaacgacccctgtcggcggc
ggaatccgatctttgaacgtagcgctcagacaagagcttgacctattcgtctgcttaaga
cctgtaagatactttactggagtgccgtcaccggtaaaacgccctgaagatactgatatg
gtcatcttccgtgaaaatacagaagatatttacgcaggcatcgagtacgcaaaaggctct
gaagaagtgcaaaagctcatcagcttcctgcaaaatgagttaaacgtcaacaaaatccgt
ttccctgagacatcaggtatcggcattaagcctgtttctgaagaaggaacaagccgtttg
gtcagagcagccattgattatgcaatcgagcacggccgcaaatctgtaacccttgttcac
aaaggaaacatcatgaagttcacagaaggcgccttcaaaaactggggctatgaacttgct
gaaagagaatacggcgaaaaagtcttcacatgggctcaatatgaccgcattgctgaagaa
caaggaaaagacgctgccaacaaagcgcaaagtgaagcggaagcagcaggcaaaatcatt
gtcaaagacagcattgctgacatcttccttcagcagattttaacgcgaccgaacgaattt
gatgtcgttgcaactatgaacctgaacggagattacatctctgatgctcttgccgcgcaa
gtcggcggaatcggcattgcacctggagcaaatatcaactatgaaacaggacatgcgatt
ttcgaggcgacgcacggaacggctcctaaatatgcaggccttgataaagtaaacccatct
tcagttattctttcaggcgttctgcttcttgagcatttagggtggaacgaagcggctgat
ttggttatcaaatctatggaaaaaacaatcgcttctaaagtcgtaacttacgattttgcc
agattaatggacggcgcgactgaagtgaaatgttcagagttcggagaagaactgattaaa
aacatggactaa

DBGET integrated database retrieval system