KEGG   Bacillus intestinalis: BIS30_05750Help
Entry
BIS30_05750       CDS       T05513                                 

Definition
(GenBank) membrane protein
  KO
K07090  uncharacterized protein
Organism
bit  Bacillus intestinalis
Brite
KEGG Orthology (KO) [BR:bit00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BIS30_05750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AJW84701
LinkDB All DBs
Position
complement(1059220..1060041)
Genome map
AA seq 273 aa AA seqDB search
MSFVILVVLGLIAGTVGSLIGLGGGIVIVPSLMFLSTVTPLFQDVTPQVAIGTSLLVIIF
TGLSSTLAYIKYKTVDYKSGLIFFIGSGPGSIIGAYVSKLFNSNSFSIWFGIFMILISLS
LMLKAKARPVNKAHKGIIRTFQDDAGEPYTYSYQAPIGIAIAFVVGFLGGLFGIGGGSLM
VPAMMLLFLFPPKVAVATSMFIIFLSSMTGSVSHVISGHVNWLYALALVPGAWFGGKLGA
AINRKMQTKTIVMIMRIVLILIGCQLIYEGIFS
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttgtgattttggtcgtactgggattaatcgcaggtacggttggaagtctgatt
gggcttggcggcggaattgttatcgtgccgtctctgatgtttctaagcacagtgacgccg
ctgtttcaggatgtaacgccgcaggtcgcaattggaacttcgcttttggtcattattttt
acgggtctttcatcaactttggcttatattaaatataaaactgttgattataagagcggg
ctcattttctttatcggttcaggtcccggcagtattatcggggcttacgtctcaaaattg
ttcaattcaaactcgttttccatatggtttggcatttttatgattcttatttcattatcc
ttaatgctgaaagcgaaagcccggccggtcaacaaagctcataaagggattattcggaca
tttcaggatgatgccggcgagccttatacatactcatatcaggctcctattggcattgcg
attgcctttgttgtcggctttttaggggggcttttcggaataggcggcggatcgctcatg
gttccggcgatgatgctgttattcctgttcccgccgaaggttgcggtggcaacgtccatg
tttattattttcctgtcctctatgacagggtctgtttcacatgttatttccgggcacgtc
aattggctgtatgcactcgcgcttgtgcccggcgcttggttcggcggaaagcttggcgcc
gccatcaacagaaaaatgcaaacgaaaacgatcgtaatgatcatgcggatcgtattgatt
ttgatcggttgccagctcatttatgaaggcatattcagctga

DBGET integrated database retrieval system