KEGG   Bacillus intestinalis: BIS30_06065Help
Entry
BIS30_06065       CDS       T05513                                 

Definition
(GenBank) hypothetical protein
Organism
bit  Bacillus intestinalis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2573
Motif
Other DBs
NCBI-ProteinID: AJW87457
LinkDB All DBs
Position
complement(1114871..1115116)
Genome map
AA seq 81 aa AA seqDB search
MEQKLQEQLDGLLEKYTELLLGDTNNELKEEVKQWILYTHIAKSMPPLAKHWNATYPDAK
QGIKDIIQHIKELNEAHRNKQ
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaaaacttcaggagcagctggatggattgctggagaagtatactgagcttctg
cttggtgacacaaacaatgagctaaaagaagaagtgaagcaatggattttgtacacgcat
atagccaaaagcatgccgccgctcgctaagcattggaatgcgacatatcctgatgcgaag
cagggcattaaagatatcattcagcatattaaggaattaaatgaagcgcatcgaaacaaa
caatag

DBGET integrated database retrieval system