KEGG   Bacillus intestinalis: BIS30_07435
Entry
BIS30_07435       CDS       T05513                                 

Definition
(GenBank) glycosyltransferase
  KO
K22709  poly(ribitol-phosphate) beta-glucosyltransferase [EC:2.4.1.53]
Organism
bit  Bacillus intestinalis
Brite
KEGG Orthology (KO) [BR:bit00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bit01003]
    BIS30_07435
Enzymes [BR:bit01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.53  poly(ribitol-phosphate) beta-glucosyltransferase
     BIS30_07435
Glycosyltransferases [BR:bit01003]
 Others
  Other glycosyltransferases
   BIS30_07435
SSDB
Motif
Pfam: Glycos_transf_2 TarS_C1 Glyco_tranf_2_3 Glyco_tranf_2_2 Glyco_tranf_2_4
Other DBs
NCBI-ProteinID: AJW85007
LinkDB
Position
complement(1389325..1391229)
AA seq 634 aa
MKISIVIPVYNSEDLISECLDSLVNQTMPKEDYEIICVDDKSTDSSLDILNQYKKKYENV
VVIERTVNSGGPGAPRNDAIKIAKGEYILFVDSDDYIGSEALLRWYNFSKENQSDITLGK
LKGINGRGVPKSMFKETNPDVDLVDSKIVFTLGPQKLFKASLLKENKITFPTHIKAAEDQ
VFTMNAYLKAKKISVSADYDYYYLVKRDGEHMSVAYVPPENFYGAMEDIISAIKASDLEE
ARKIKLMAVFLNRHFDFSRTKNVTIKMKTDEERAEWFRYLSSFIHAVPEEADQFVLPHIK
LRLLFIRNNDLRGLTQYEREEQDIKKFCTVNNGELIARYPSLERYSISEELLKVNYKNKL
EHYLQNIEFSDHSLSIQGTITHKLLDDETNKNQSLTGVFVHRDTKAEKYIAPASYDNSTF
TFECKFDELASAEEDLGVWDFFIESSIDGYKLRARIGNKRAAYKYSTKTMYLGHNALFVY
SARPYFTMNYDNLSIDIKKHAYTEAELSYETESKDLSFIFKDKQIYLPNHSKIIVNTGQS
EISLPVKRIDLEPNCTKLTVNVQSLLEQLAHVKKERLIEFAINTSQNKISAKVDNQAIIL
DTKSVERKSMLFFNKMVEVQYKLLTSKSKFYFQY
NT seq 1905 nt   +upstreamnt  +downstreamnt
atgaaaataagcattgttatccctgtatataattcagaagatcttatttccgaatgtctt
gacagcttagttaatcagacgatgccaaaagaggattatgagattatatgtgttgatgat
aaatctacggattcatctttagacattttgaatcaatataaaaagaaatatgaaaatgtt
gttgttattgaaagaacggtaaactcaggcggtccaggtgctccgcggaatgatgcaata
aaaattgccaagggtgaatacattctatttgttgattccgatgactatataggcagtgaa
gcattgttaagatggtacaatttctcaaaagagaatcaatcagatattacattaggaaag
ttaaaagggataaacggcagaggtgttcccaaatcaatgtttaaggaaacgaacccggat
gttgatttggttgattccaagattgtttttacattgggaccccaaaaactgtttaaagcc
tcacttttaaaagaaaataaaattaccttccctactcacataaaagcagcggaagatcaa
gtcttcacaatgaatgcttatttgaaagcaaagaagatttctgtttcagctgactatgat
tattactatctggtcaaaagagacggtgaacatatgagtgttgcatatgttcctccagag
aacttttatggagcaatggaagatattatctctgctatcaaggcaagtgacctggaagaa
gccagaaaaattaagctgatggcagtatttttaaacaggcattttgatttttctcggaca
aaaaatgtcacgattaaaatgaaaaccgatgaagaaagagctgaatggtttagatatttg
tcatcatttattcatgcagtgcctgaagaggctgatcaatttgtacttccgcatattaaa
ttgcggctgctgtttattcggaataatgatttgcgaggattaacccagtatgagcgggag
gaacaagacattaaaaagttctgtactgttaataacggggagttaattgcacgttatccg
agcttagaacggtattcaatttctgaagagctattaaaagtaaattataaaaataagctt
gaacattatctgcagaatattgaatttagcgatcatagcctcagcattcaaggaaccatt
acacacaaattgttggatgatgaaacgaataaaaatcaatctctgacaggagtatttgta
catcgtgatacaaaggcggaaaaatacattgcgccggcttcatatgataattcaactttt
acatttgagtgcaagtttgatgaactggcttctgctgaagaagatttaggtgtttgggat
ttctttattgaatcgtcaatagacggctacaaattaagggcaagaataggaaacaagcgt
gccgcgtacaagtattccacaaaaacgatgtatttagggcataacgctttgtttgtctac
agcgccagaccatactttacaatgaactatgataacctttcgattgatataaagaaacat
gcatatacagaagctgaactttcttatgaaacagaatcaaaggatttatcatttattttt
aaagataagcaaatctatttgccaaatcattcaaaaatcattgtgaataccggacagtct
gaaatttcattaccagtaaaacgtattgatttagagcctaattgcacaaaattgacggta
aacgtgcagagtttgcttgaacagctagctcatgtaaagaaagagcgattaattgaattt
gcgataaatacttctcaaaataaaatcagtgcaaaagtggacaaccaagcaattatccta
gacacaaaaagcgtggaacgaaaatccatgttattcttcaataaaatggttgaagttcaa
tacaagctgttaacctctaaatcaaaattttattttcaatattaa

DBGET integrated database retrieval system