KEGG   Bacillus intestinalis: BIS30_10195Help
Entry
BIS30_10195       CDS       T05513                                 

Definition
(GenBank) hypothetical protein
Organism
bit  Bacillus intestinalis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2798 EBP
Motif
Other DBs
NCBI-ProteinID: AJW85508
LinkDB All DBs
Position
1943978..1944457
Genome map
AA seq 159 aa AA seqDB search
MPANKKEGLIFGVMMCFGMVCVMSIYNAIINGAIHDFSLVTAFEMVIGFIVALLLDLLLV
GPLAKKIAFSMPFDKSKKLYVILAMSTCMVIGMVLCMSVFGLVTAALSNGLNGDSLFSAY
LMIVLKNFILAYPLQLLIMGPLVRGVFMKFVKPKLTAAV
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgccagcgaataaaaaagaaggtcttatatttggcgtgatgatgtgttttggaatggtc
tgtgtcatgtcgatttacaatgccatcatcaacggagctatacatgatttttcattggta
acagcttttgaaatggtcatcggttttattgtcgccctgctgttagatttactgttagtg
ggtccccttgccaaaaagattgcattcagcatgccgttcgacaagtctaagaaattatat
gtcatccttgccatgtcgacgtgtatggtgatcggcatggtgctttgtatgtctgtgttc
ggtttagtgacagcagctttatcaaacggacttaacggggacagcctcttcagcgcttac
cttatgattgtattgaaaaatttcatcttagcttatcctttgcaattactgattatgggt
ccattagttagaggggtttttatgaaatttgtaaaaccaaagctcacagctgctgtttaa

DBGET integrated database retrieval system