KEGG   Bacillus intestinalis: BIS30_10220Help
Entry
BIS30_10220       CDS       T05513                                 

Definition
(GenBank) hypothetical protein
Organism
bit  Bacillus intestinalis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_10 Acetyltransf_1 Acetyltransf_7 FR47 Acetyltransf_5 Acetyltransf_9 PanZ
Motif
Other DBs
NCBI-ProteinID: AJW85513
LinkDB All DBs
Position
1947376..1947822
Genome map
AA seq 148 aa AA seqDB search
MNIKRITAENDLQVALDIRKAVFIEEQHVSESDEFDQFDALQEQCQHVLVYHKNQPVGTG
RVRIVDQTGKLERICILKPYRKYGLGKVIIGELEKIMKEKGITKMKLHGQTHAEGFYKKL
GYQTASDEFMEDGIPHILMTKEISRNIT
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaatataaaaagaataactgctgaaaatgacttacaagttgctttagatattagaaaa
gcggttttcattgaagagcaacatgtatctgaatccgatgagttcgatcaatttgatgcc
ctccaggaacaatgccagcatgtcttggtatatcataagaatcaacctgtcggcacaggc
cgtgtgcgcatcgttgatcagacaggtaagctggaaagaatctgtatcctaaaaccttat
cggaagtacggattgggtaaagtcatcattggagagctagaaaaaatcatgaaagaaaaa
ggaataactaaaatgaagctgcatggacaaacacatgcagaaggtttttataaaaaactg
ggctatcaaactgcttcagatgaatttatggaagacggcatcccgcacatcttgatgaca
aaagaaatatcgcggaatataacatga

DBGET integrated database retrieval system