KEGG   Bacillus intestinalis: BIS30_10225Help
Entry
BIS30_10225       CDS       T05513                                 

Definition
(GenBank) hypothetical protein
  KO
K07149  uncharacterized protein
Organism
bit  Bacillus intestinalis
Brite
KEGG Orthology (KO) [BR:bit00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BIS30_10225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YitT_membrane
Motif
Other DBs
NCBI-ProteinID: AJW85514
LinkDB All DBs
Position
1947819..1948409
Genome map
AA seq 196 aa AA seqDB search
MKYIYYGLGILILSLGISLTIQSGLGTSPFDALLVGLSEEVGLTVGSWEVLISVILLICN
SILTRKKPILLGLVTAFITGIGIDLWLFVVNYTIYLNALLSKLICFGFGLMFIGLGTAIY
LHTKFASTPIDHLTLIIRDLSKRTILFSRTLVYALFLVLAIICKGPIGIGTLLTVCLGGM
ILHFFMPFVERRFLKM
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatatttattacggattaggcattctcatattaagtttgggcatttctttaacg
atacaatcaggactgggcacatcccccttcgatgcccttttggttggtctttcagaagaa
gttggtcttaccgtgggaagctgggaggtccttatttctgtgatcctcttaatctgtaac
tctatcttaacgagaaaaaaacctatattgctggggttagtcacagcattcattactggg
ataggcattgacctatggttgtttgttgtaaactacaccatttatctaaacgcgttgtta
agcaaactgatttgtttcggatttggtttgatgttcatcggtcttggaacagccatctat
cttcatacgaaatttgcatcaacgcctatcgatcatttaacactcatcatccgagatctc
tccaaaagaacgatcttattttcaagaacattggtatatgctcttttcttagtattagct
attatatgtaaaggccctatcggcatcggaacgcttttaactgtttgtttaggaggaatg
atccttcacttttttatgccttttgttgaacgacgttttttaaaaatgtaa

DBGET integrated database retrieval system