KEGG   Bacillus intestinalis: BIS30_12180Help
Entry
BIS30_12180       CDS       T05513                                 

Definition
(GenBank) thioredoxin reductase
  KO
K21567  ferredoxin/flavodoxin---NADP+ reductase [EC:1.18.1.2 1.19.1.1]
Organism
bit  Bacillus intestinalis
Brite
KEGG Orthology (KO) [BR:bit00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BIS30_12180
Enzymes [BR:bit01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.2  ferredoxin---NADP+ reductase
     BIS30_12180
  1.19  Acting on reduced flavodoxin as donor
   1.19.1  With NAD+ or NADP+ as acceptor
    1.19.1.1  flavodoxin---NADP+ reductase
     BIS30_12180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox DAO HI0933_like NAD_binding_8 Thi4 Amino_oxidase NAD_binding_7 FAD_oxidored FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AJW85845
LinkDB All DBs
Position
2310812..2311822
Genome map
AA seq 336 aa AA seqDB search
MAENQEVYDVTIIGGGPIGLFTAFYCGMRELKTKVIEFLPRLGGKVSLFFPEKIIRDIGG
IPGIAGKQLIKQLKEQAATFDPDIVLNQRVTGFERLEDGTIVLTGSEGEKHYTRTVILAV
GMGTLEVNEFDSEDATRYAGKNLHYGVEKLDAFKGKRVVISGGGDTAVDWANELEPIAAS
VTVVHRREEFGGMESSVTKMKQSSVRVLTPYCLEQLSGDEDRIQSVTVCHTASGQREDIA
VDELIINHGFKIDLGPMKGWGLEIEEGRVKADRHMRTNLPGVFVAGDAAFYESKLRLIAG
GFTEGPTAVNSAKAYLDPKAENMAMYSTHHKKLVHK
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaatcaagaggtatatgacgttacgattataggcggggggccgatcggactg
tttacagctttttactgcgggatgcgggagctgaaaacgaaagtaatcgaatttttgccg
cggctcggagggaaggtgtctttattctttcctgagaaaatcattcgcgatatcggcgga
ataccagggattgcaggaaagcagctgatcaagcagctgaaagagcaggcggcgacgttt
gatcctgatatcgtgctgaatcagcgtgtgaccggatttgaacgcttggaagacggcacc
attgtgctgacaggttctgaaggagaaaagcattatacacgtaccgtgattttagctgtc
ggcatgggaacgcttgaggtcaatgagtttgacagtgaggatgcgacccggtatgcgggc
aaaaatcttcattatggagtggagaagcttgatgcatttaaagggaagcgggtcgtgata
tcaggcggcggtgatactgcagtcgattgggccaatgagctggaaccgattgcggcgtct
gtgactgttgttcaccggcgcgaggaattcggcggaatggaaagcagcgtgacgaagatg
aagcaatcatcggtgcgggtgctcactccttattgtctggagcagctgagcggcgatgaa
gatcgcatccaaagtgtgactgtttgtcatactgcgtctggccagagggaagacatagcg
gttgacgagctgatcattaaccatgggttcaaaattgatctcggaccgatgaaggggtgg
gggcttgagattgaagaaggcagggtgaaagctgacagacatatgcggacgaatcttccg
ggtgtgtttgtggcgggtgacgcggctttttatgaaagcaaactgagattgattgccggc
ggctttacggaaggcccgacagcggtcaacagcgcgaaggcttatttggaccctaaggcc
gagaatatggcgatgtattcaactcatcacaaaaaattagtgcataaataa

DBGET integrated database retrieval system