KEGG   Bacillus intestinalis: BIS30_12200Help
Entry
BIS30_12200       CDS       T05513                                 

Definition
(GenBank) nitrite reductase
  KO
K00372  assimilatory nitrate reductase catalytic subunit [EC:1.7.99.-]
Organism
bit  Bacillus intestinalis
Pathway
bit00910  Nitrogen metabolism
bit01100  Metabolic pathways
bit01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bit00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BIS30_12200
Enzymes [BR:bit01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.99  With unknown physiological acceptors
    1.7.99.-  
     BIS30_12200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Molybdopterin Molydop_binding Molybdop_Fe4S4
Motif
Other DBs
NCBI-ProteinID: AJW85849
LinkDB All DBs
Position
complement(2316255..2318387)
Genome map
AA seq 710 aa AA seqDB search
MTERLLRYFRDKQQDIQSEKTYDTQCPFCSMQCKMQLVEQTIVTRKKYTAIGIDNPTTQG
RLCIKGMNAHQHALNSSRITRPLLKKNGEFMPVSWEEALNHIKDQVTMIQHEHGHDAMAV
YGSASITNEEAYLLGKFARVGLQTKYIDYNGRLCMSAAATAANQTFGADRGLTNPLSDIP
YTRVIILAGTNIAECQPTIMPYFEKAKDNGAYIIAIDPRETATTKIADLHLKIKPGTDAA
LANALVKIMIDEQLVNEDFIRSRTNGFAELKQHTDALSLNDIAEQTSVPLAHMRKAAVKF
AKETSGMLFTARGIEQQTDGTAAVKGFLNMVLITGKIGKPYSGYGAITGQGNGQGAREHG
QKADQLPGYRSIENEEHRSHIAKVWGIHQDDLPRKGVSAYEMMEKINDGDIKGLFLMCSN
PAVSSPNANLVKKALRKLTFFVAIDLFISETAKYADVILPASSYLEDEGTMTNVEGRVTL
REASRPCPGEAKHDWQIICEIASVLGKGRYFSYTSAKDIFNELREASRGGIADYSGITYD
RLRREGGIHWPCPEPDHPGTGRLFADSFAHPDQKAALSVIPIEPAVPKEKPTADYPLYLT
TGRVMSHYLTGVQTRKSAALAARHFESFMEIHPQTAATYNIEDRVLVKIESPRGSITVRS
KLSDQIRKDTVFVPIHWADAQNVNDLIGEALDPACKMPGFKVCAVRIRPI
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
ttgactgaacgactgcttagatatttccgtgataaacagcaagacatccaatcagaaaaa
acgtatgacacccaatgcccgttttgcagcatgcagtgcaaaatgcagctcgtggaacaa
accatcgtcacacggaaaaagtacacagcgatcgggattgataatcctacgacacagggc
cggttatgcataaagggcatgaacgcccaccagcatgccctgaactcctcccgcatcacc
cggccgctgctgaagaaaaatggtgaatttatgcctgtttcctgggaagaagcactgaat
catatcaaagaccaagtgactatgattcaacacgaacacggccatgatgccatggctgta
tacggaagcgcctcgattacgaatgaagaagcgtatttgttagggaagttcgcacgggtt
ggcttacagacaaaatacatcgactacaacgggaggctttgtatgtccgccgcagcaacc
gcagccaaccaaacatttggtgcggacagaggcttaacgaatcccttatcagacattccc
tacacccgtgtgatcattctggccggcaccaatattgcggaatgccaaccaacaattatg
ccgtattttgaaaaagcgaaagacaacggcgcttacatcattgccattgatccgcgcgag
acagcgacgacgaaaatcgccgatcttcatctgaaaatcaaacccggcacagacgccgcc
cttgccaacgccctcgttaaaatcatgatcgacgagcagctcgtaaacgaagatttcatt
cgatcacgaacaaatggattcgcagagctgaaacaacatactgacgcattgagcctgaat
gatatcgccgaacagacaagtgtcccgctggcccacatgcgaaaagccgctgtgaagttt
gccaaggaaacatccggcatgctgtttacagcccgcgggattgaacagcaaaccgatgga
acagcggctgtaaagggtttcttaaacatggtgctcatcacaggaaaaatcggcaaacct
tactcggggtatggggcgatcaccggacaaggcaacgggcaaggcgccagagagcatggc
caaaaagccgatcagctcccgggctaccgttctattgaaaacgaagaacatcggtcgcat
attgcgaaagtgtggggaattcaccaggatgatctgccgcgaaaaggtgtctcagcctat
gaaatgatggaaaaaatcaatgacggtgacatcaaagggctgttcctcatgtgttcaaat
cctgctgtctccagcccaaatgcaaacctcgtgaaaaaagctctgagaaaactgacattc
tttgtcgcgatcgatttgtttatttctgagactgcgaaatacgcagatgtgattttgccc
gcctcctcttatttagaagatgaggggaccatgacaaatgtcgaaggccgcgtgactttg
agagaagcaagccggccgtgtcccggtgaagcaaagcatgattggcagatcatttgtgag
atcgcatccgttctcgggaagggccgttatttttcttacacgtcagcaaaggatattttt
aatgagttgagagaagcaagccgaggcgggattgctgattattcaggcatcacatacgac
aggctcagacgtgaaggcggcattcattggccatgtccagaacctgatcatcccggaaca
gggcgtttgtttgcggactcatttgcacatcctgatcaaaaagcggcactaagtgtgatt
ccaatcgaaccggctgttccaaaagagaagccgacagccgattatccgctgtatttaacg
acaggcagggtcatgtctcattacttaacaggcgtccaaacgagaaaaagcgccgccctt
gccgcgagacactttgaatcatttatggaaatccatccacaaacagcagcgacctacaat
atcgaggaccgtgtactggtaaaaatagaatcccctcggggaagcatcaccgtccgcagc
aaattatcagaccaaatcagaaaagacaccgtttttgttcccatccactgggcagatgct
caaaatgtgaatgatttaatcggtgaagctttagatccagcctgtaaaatgcccggtttt
aaggtatgcgccgtccgaatcagacctatttaa

DBGET integrated database retrieval system