KEGG   Bacillus intestinalis: BIS30_12205Help
Entry
BIS30_12205       CDS       T05513                                 

Definition
(GenBank) nitrate reductase
  KO
K00362  nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Organism
bit  Bacillus intestinalis
Pathway
bit00910  Nitrogen metabolism
bit01100  Metabolic pathways
bit01120  Microbial metabolism in diverse environments
Module
bit_M00530  Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:bit00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BIS30_12205
Enzymes [BR:bit01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     BIS30_12205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Fer2_BFD Pyr_redox Rubredoxin_C Pyr_redox_3 NIR_SIR_ferr NIR_SIR HI0933_like GIDA 3HCDH_N AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AJW85850
LinkDB All DBs
Position
complement(2318384..2320708)
Genome map
AA seq 774 aa AA seqDB search
MKKQRLVLAGNGMAGIRCIEEVLKLNRQMFEIVIFGSEPHPNYNRILLSSVLQGEASLDD
ITLNSKDWYDKHRITLYTGETVVQIDTDQQRVITDRKRTLSYDKLIVATGSSPHILPIPG
ADKEGVYGFRTIEDCQALMSMAKHYQKAAVIGAGLLGLEAAVGLQHLGMDVSVIHHSAGI
MQKQLDQTASRLLQTELERKGLTFLLEKDTVAISGTSRADGIRFKDGSSLKADLIVMAAG
VRPNIQLVVSAGIAVNRGIIVNDDMQTSEPNVYAVGECAEHNGTVYGLAAPLYEQGKALA
KHICGVPCEGYQGSAPSAALKIAGIDVWSAGKVHEDERTTSIKIYDEQTGIYKKALFEDD
KLAGVILFGDTRDKQRFLDSLLKQRDISIVKKQIIEPEKTGTLFDSMSSSETICQCNSVT
KGAIEEAVHTKGLTTVEEVKHCTKASGSCGGCKPLVEDLLRYMTSSEYTEPAGTPSFCGC
TDFTEDDIIAELQRRPFANPAEAMNQLGWKTKNGCGKCVPAIQYYLEMLHPGFVQPESAA
EDTYILIPQMYGGRTNAEQLRNIANIIEAYSIPDVSITHGQRLKLSGIKPADLPNIKKDL
IMPVRSNEHHRTLQSVKACTCGQNRSIQQLAAQIERHLEMLSMPAYISISLSCETDCTDA
AIQDFGAIQTQAGWDIYIGGIRGTHARSGALFCVTDNADSTAGMIKGLIQYYRETAHYLE
TVHQWMDRLGIVHIREVLFEEDLRTQLLESLQTDLSLIPKPPVQAGTHKRGEAF
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacaaagattagtgttagcagggaatggaatggccggaatccgctgtattgaa
gaagttttaaagctgaatcgccaaatgttcgaaattgtcattttcggaagcgaaccgcat
cccaactataatcgcattctcttatcctctgtactgcaaggtgaggcgtcactcgatgac
attacactgaacagcaaggattggtacgacaagcacaggattactctttacacaggcgaa
acggttgttcaaattgatacagatcagcagcgggttatcacggatcggaaacgcaccctg
tcttatgacaaattaatagtggcaacaggctcctcccctcatattctccccatccccggg
gcggacaaagaaggcgtctacggatttcgaacaatagaagactgccaagcgttgatgagc
atggccaaacattatcaaaaggcagcggtgatcggagccggcttattaggactcgaagcc
gcagtcggtttacagcatctcggcatggatgtcagcgtcattcatcactcagccggcatt
atgcaaaaacagctcgatcaaacggcgtcgcggctgctgcagacggagctggagcggaaa
ggcttaacctttcttttggaaaaagacaccgtagccatttctggcacctcgcgggcagac
ggcatccgttttaaagacggctcttcattgaaagctgacttgattgtgatggcggctggc
gtgaggccgaatattcaattggttgtgtcagccggaatcgcagtaaaccgcgggatcatc
gtgaatgacgacatgcagacgagcgaaccgaatgtgtatgccgtcggcgaatgcgccgag
cataacggaacggtgtatggtttggcagccccgctttacgaacagggaaaagctctcgcc
aaacatatttgcggtgttccatgtgaggggtatcaagggtcagcaccatctgcagcttta
aaaatagctggaattgatgtgtggtcagctggaaaggttcacgaggatgaacgcacaacg
agtattaaaatctacgatgaacaaacaggcatttataaaaaagcactctttgaggatgac
aaactggccggcgttattttattcggagatacacgtgacaagcagcgatttctcgacagc
ctgctcaaacaaagagacatctccattgtcaaaaagcagatcatcgaaccggagaaaacc
ggcactttatttgattccatgtcttccagtgaaacgatttgccaatgcaactcagtgacg
aaaggcgcgattgaagaagcggtgcacacgaaaggcctcacaactgttgaggaagtcaag
cactgcaccaaagcatctgggtcctgcggaggatgcaagccgctcgttgaagaccttttg
aggtacatgaccagcagcgaatatacagagcccgctggcactccttcgttttgcggctgt
actgattttacagaagacgacatcattgccgagcttcagcgcaggcctttcgctaatccg
gcagaagcaatgaaccagcttggctggaaaacgaaaaatggatgcggcaaatgtgttccg
gcgattcaatactacctggaaatgcttcatcccggttttgttcagcctgagtcagccgcc
gaagatacatacatcctcattccgcaaatgtacggcgggcgaacgaacgcggagcagcta
agaaacatcgccaatatcatcgaggcatacagcatccctgacgtatccatcactcacggc
caaagactgaagctttccgggatcaaacccgcggatctcccaaacatcaaaaaagacctg
ataatgcccgtacgctcaaacgaacaccaccgcacgctgcaaagtgtcaaagcatgtaca
tgcggacaaaaccgatcgattcaacagctggcagcccagatcgagagacatcttgagatg
ctttccatgcccgcttatatttctatcagcttatcatgtgaaacagactgcaccgatgcc
gccatacaagattttggcgcgattcagacccaggctggctgggacatttacatcggcggc
attcgtggaacccatgcccgttccggagctctgttttgcgttacagacaacgcagacagc
acggccggcatgatcaaaggactgatccaatattaccgtgagacggctcattacttagaa
accgttcaccagtggatggaccgactcgggatcgttcatatcagagaagtgctattcgaa
gaggaccttaggacacagctgctggaaagcctccaaacagacctgtcactgattccaaaa
ccgcctgtacaggctggcacacataaaaggggtgaggcattttga

DBGET integrated database retrieval system